KEGG   Delftia acidovorans: Daci_5833Help
Entry
Daci_5833         CDS       T00620                                 

Definition
(GenBank) plasmid stabilization system
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParE_toxin MIT
Motif
Other DBs
NCBI-ProteinID: ABX38461
UniProt: A9C0Z8
Position
complement(6490374..6490691)
Genome map
AA seq 105 aa AA seqDB search
MNYRVVFSSQAQEQLVELYRYIAEAASHDVAAQYTDAIVSYCESLRTFPLRGTPRDDVRP
GLRITNYRKRTVIAFAVDADMVSIIGIFYGGRDHEALLREGGGIA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcgcgttgtcttcagttcgcaggcccaggagcagcttgtcgagctttaccgc
tacatcgccgaggctgcctcgcacgatgtggcagctcaatacaccgatgccatcgtgagc
tattgcgagagcctgcgcacctttccacttcgcggcacgccgcgcgacgacgtgagacct
ggcttgcgcatcaccaactacagaaagcgaactgtcatcgccttcgccgtcgatgcagac
atggtttccatcatcggcatcttctatggcgggcgtgaccacgaagcactgctgcgggag
ggtggcgggatcgcctga

DBGET integrated database retrieval system