KEGG   Delftia acidovorans: Daci_5834Help
Entry
Daci_5834         CDS       T00620                                 

Definition
(GenBank) putative transcriptional regulator, CopG/Arc/MetJ family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParD_antitoxin RHH_1
Motif
Other DBs
NCBI-ProteinID: ABX38462
UniProt: A9C0Z9
Position
complement(6490688..6490957)
Genome map
AA seq 89 aa AA seqDB search
MRTTQQMSITLPNDMADAVRAKVRAGEYASESEVIRDGLRALMARDRAVESWLQDQVGPA
YDALKADPSSAVTADQLRARLAAEHAKAR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccacccagcaaatgagcatcaccctgcccaacgacatggcagacgcagtacgg
gcgaaggtgcgtgctggcgagtacgccagcgagagcgaagtgatccgtgatggcttgcgg
gcgctgatggcacgggatcgtgcggtggaaagctggctgcaagatcaggtcggccccgcc
tatgacgcgttgaaggccgatccctcgagtgccgtaaccgccgatcaattgcgggcgcgc
cttgccgctgaacatgccaaggcgagatga

DBGET integrated database retrieval system