KEGG   Delftia acidovorans: Daci_5870Help
Entry
Daci_5870         CDS       T00620                                 

Definition
(GenBank) Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
  KO
K00697  trehalose 6-phosphate synthase [EC:2.4.1.15 2.4.1.347]
Organism
dac  Delftia acidovorans
Pathway
dac00500  Starch and sucrose metabolism
dac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Daci_5870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dac01003]
    Daci_5870
Enzymes [BR:dac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     Daci_5870
    2.4.1.347  alpha,alpha-trehalose-phosphate synthase (ADP-forming)
     Daci_5870
Glycosyltransferases [BR:dac01003]
 Others
  Trehalose
   Daci_5870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_20
Motif
Other DBs
NCBI-ProteinID: ABX38498
UniProt: A9C135
Position
6527147..6528691
Genome map
AA seq 514 aa AA seqDB search
MSRLVVISNRVADPAKAAAGGLAVAMGDALRQTGGLWFGWSGTVTDGHAAAPAGHVHRTQ
AGKVTLATVDLDRADHDSYYAGYSNGVLWPVFHGRLDLANFDTGLAAGYRRVNQLLARRL
LPLLAEDDILWVHDYHLIPLAAELRALGCRQRIGFFLHIPLPPPTLLAAIPEHAWLMRCL
FAYDLMGLQTRQDVQHFERYVCEEAGGQTLGDGAFRAHGQRMVCRDFPIGIDVDGFMALA
QGGASRDMYERMKHEYAQRRLLLGIDRLDYSKGLPQRLRAFRELLARHPEQRRRATLIQI
GSPTREGLDAYADIRRELESLCGAINGDYGELDWMPVRYIHQTLPRDSIPGLCRAAAVGL
VTPLRDGMNLVAKEYVAAQDPADPGVLVLSRFAGAAEQLHEALLVNPYDVHGTAAVVQQA
LHMPLHERRQRHQRLLQRVCEQDVHWWRKAFLSALKETRPQERRDRDWSKEREAGFGIPV
PSMRQERPPLGLELPACPADALALDASRSVVSDR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctggtggtgatctccaaccgcgtggccgacccggccaaggcagccgcaggc
ggcctggccgtggccatgggcgatgcgttgcggcagaccggcggcctgtggttcggctgg
agcggcacggtcaccgatggccacgccgccgcccctgccgggcatgtgcaccggacccag
gcaggcaaggtcacgctggccaccgtggacctggaccgtgcggaccacgacagctactac
gcgggctacagcaacggcgtgctgtggcccgtcttccatggccggctggacctggcgaat
ttcgacacgggccttgcggccggctaccgccgcgtgaaccagctgcttgcgcgccggctg
ctgcccctgctggcggaggacgacatcctctgggtgcatgactaccacctgatcccgctg
gcggccgagctgcgcgccctgggctgccgccagcgcatcggttttttcctgcacatcccg
ctgccgccaccgaccctgctggcggccattcccgagcatgcatggctgatgcgctgcctg
ttcgcctatgacctgatgggcctgcagacacgccaggacgtgcagcatttcgagcgctat
gtctgcgaggaggcgggcggccagaccctgggtgacggcgcattccgcgcccatggccag
cgcatggtctgccgcgacttccccataggcatcgatgtggatggtttcatggcgcttgca
cagggcggcgcctcgcgggacatgtacgagcgcatgaagcacgaatacgcccagcgccgc
ctgctgctgggcatagaccggctggactactccaagggcctgccgcagcgcctgcgcgcc
ttccgggagctgctggcccgccatcccgagcagcgccgccgcgccacgctgatccagatc
ggctcgcccacgcgcgagggcctggacgcgtatgccgacatacggcgtgaactcgaatcg
ctgtgcggcgccatcaacggcgactacggcgagctggactggatgcccgtgcgctacatc
caccagaccctgccgcgcgacagcattccgggcctgtgccgtgcggcggccgtgggcctg
gtcaccccgctgcgcgatggcatgaacctcgtggccaaggagtacgtggcggcccaggac
ccggccgacccgggcgtgctggtgctgtcgcgctttgcgggcgcggccgagcagttgcac
gaggcgctgctggtcaatccctatgacgtgcatggcacggccgccgtggtgcagcaggcc
ctgcacatgccgctgcacgaacggcgccagcgccaccagcggctgctgcagcgcgtatgc
gagcaggacgtgcactggtggcgcaaggcctttctgtccgcattgaaggagaccaggccg
caggagcgccgtgacagggattggagcaaggaaagagaagccggcttcggcatccccgtg
ccgtctatgaggcaggaacgcccgccgctgggcctggagttgcccgcctgcccggcggac
gccctggccctggacgccagccgatcggtggtctccgacaggtaa

DBGET integrated database retrieval system