KEGG   Delftia acidovorans: Daci_5875Help
Entry
Daci_5875         CDS       T00620                                 

Definition
(GenBank) DinB family protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB DinB_2
Motif
Other DBs
NCBI-ProteinID: ABX38503
UniProt: A9C140
Position
complement(6532086..6532577)
Genome map
AA seq 163 aa AA seqDB search
MLVRYKAWANGLTFKSVMELPEGEALKQRPTSFGNMVRTLNHVLVVEDIFRHHLQGRKHG
YTMRNTDHTPTLPALWESVQAMDRWYVEFVDACPDEVLAKVVHFEFVGGGQGAMTREQIV
LHVVNHGSYHRGFVSDMMYQVPFVPPANDLPVFLRDCYREDKG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgcgctacaaggcctgggccaacggcctgaccttcaagagcgtgatggagctg
cccgaaggcgaggccctgaagcagcgccccacgagcttcggcaacatggtgcgcacgctg
aaccacgtccttgtggtggaggacatcttcaggcaccacctgcagggccgcaaacatggc
tacaccatgcgcaacaccgaccacacgcccacgctgccggcgctgtgggaatccgtgcag
gcaatggaccgctggtatgtggaattcgtcgatgcgtgcccggacgaagtcctggcgaag
gtcgtgcacttcgagttcgtgggcggcgggcagggcgccatgacgcgcgagcagatcgtg
ctgcacgtggtgaaccacggcagctaccaccgtggcttcgtgagcgacatgatgtaccag
gtgcccttcgtgcctccggccaacgacctgccggttttcctcagggattgctaccgcgaa
gacaagggctga

DBGET integrated database retrieval system