KEGG   Delftia acidovorans: Daci_5876Help
Entry
Daci_5876         CDS       T00620                                 

Definition
(GenBank) phenazine biosynthesis protein PhzF family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhzC-PhzF Pro_racemase
Motif
Other DBs
NCBI-ProteinID: ABX38504
UniProt: A9C141
Position
complement(6532660..6533499)
Genome map
AA seq 279 aa AA seqDB search
MVDVFASGPLSGNPLAVITGGQALTTAQMQQLTRWFNLSETAFLLPPTQAQADYRVRIFT
LDREMPFAGHPTLGSCHAWLSQHGAPRNAGHIVQECGAGLVQIRQEHGRLAFAAPPMLRF
GAPTADELDAALRMLGITAEEVQAASWIDNGPGWLGIRLASAEQVLALNPARQWPTRMDV
GVVGPYARGVGGASPAACEVRAFFSDHQGAIVEDPVTGSLNASLAQWLFATGVMDSDYIA
AQGRCLGRDGRIFLTRDGTGQVWVGGTARTHVEGALSGL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgttttcgccagcggcccgctgtccggcaatccgctggccgtgatcaccggt
gggcaggcgctgaccaccgcacagatgcagcagctgacacgctggttcaacctctccgaa
accgcgttcctgctgccgcccacgcaggcgcaggccgactaccgcgtgaggattttcacg
ctggaccgggagatgccttttgccggccatcccacgctgggcagctgccatgcctggctg
tcccagcacggtgcgcccaggaacgcaggccacatcgtccaggagtgcggggcgggactg
gtgcagatacggcaggagcatgggcggctggcattcgccgcgccgcccatgctgcgcttt
ggcgcgcccaccgccgatgagctggatgccgcgctgcgcatgctgggcatcactgccgaa
gaggtgcaggccgcctcgtggatagacaacggccccggctggctgggcatccgcctggcc
tcggccgagcaggtgctggcgctgaacccggcccggcagtggcccacgcgcatggacgtg
ggcgtggtggggccctatgccaggggtgtcggcggtgccagccctgccgcctgcgaggtg
cgcgccttcttctccgatcaccagggcgccatcgtcgaagaccccgtcaccggcagcctc
aacgcctcgctggcgcagtggctgtttgcgacgggggtgatggacagcgactacattgcc
gcccagggccgctgcctgggccgtgacggccgcatcttcctgacccgtgacggcacgggc
caggtctgggtgggcggcactgcgcgcacccatgtcgaaggcgcactgagcggcctttga

DBGET integrated database retrieval system