KEGG   Delftia acidovorans: Daci_5878Help
Entry
Daci_5878         CDS       T00620                                 

Definition
(GenBank) transcriptional regulator, GntR family with aminotransferase domain
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR HTH_Crp_2 Rrf2 MarR_2
Motif
Other DBs
NCBI-ProteinID: ABX38506
UniProt: A9C143
Position
6534055..6535422
Genome map
AA seq 455 aa AA seqDB search
MLLPSPWTPRLARIEASAAERLARALADDIVEGRLAGGDRLPAHRDLADRLQIGLGSVTR
AYALLERRGLTRSVRGRGTFVASQQAQAGEDIDLSSNAPPAAISARVLARTLTGIARSID
TDHFNFYAPPQGHLEHRRVLARWLQTLGLNVEPDHMVLTSSARQALSLAFDLVCRPRGRL
LTERITYPGAIALARRKGCALQGLAIDAQGLLPQALADALEGIPAAEGKVVYLTPTLHNP
TTATMGAERRQAIVDICRSAGAWIIEDGVYAACLPDHASLAHLATLAPEITLHVNGLSKS
LGPGLQVGMLVLPASLGGAAVELVQEMSMAPSALSCAVIDEWLSHGVVASLQADLRHEAQ
RRCRLAASHLASHLSGSGLVLHPEAYNAWLPMEREAAGRLVSAAAALGLKLTDPGSLMVD
PQEQASGLRICLGAPRFDALDGALAQLARLLTAVP
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgccctccccctggacgccccgtcttgcgcgcattgaagccagtgccgcagag
cggctggcgcgcgccctggccgacgacatcgtcgaaggccggctggccggcggcgaccgc
cttcccgcccacagggacctggccgacaggctgcagatcggcctgggctcggtgaccagg
gcctatgcgctgctggagcgccgggggctgacacgcagcgtcaggggccggggcaccttc
gtggcgtcacagcaggcgcaggctggcgaggacatcgacctgtcttccaacgcgccgccg
gccgccatcagtgcgcgcgtcctggctcgtacgctgaccgggattgcgcgcagcatcgat
accgatcatttcaacttctatgccccgccccagggccacctggagcatcgccgcgtgctc
gcgcgctggctgcagacgctgggcctgaacgtggaacccgaccacatggtgctgaccagc
agcgcgcgccaggctctgtccctggccttcgatctggtctgtcggccccggggccggctg
ctgaccgagcgcatcacctaccccggcgccattgccctggcccggcgcaagggctgcgcc
ctgcagggcctggccatcgacgctcagggcctgctgccgcaggcgctggccgatgcgctg
gagggcattcccgccgccgaaggcaaggtggtctacctcacccccacgctgcacaacccg
accacggccaccatgggcgcggagcgcaggcaggcgatcgtggacatctgccgcagcgca
ggcgcctggatcatcgaggacggcgtgtacgccgcctgcttgcccgatcacgcatccttg
gcccatctggccacgctggcgcccgagatcacgctgcatgtgaacgggctgtccaagtcc
ctgggcccggggctgcaggtgggcatgctggtgctgcccgcttcgctgggcggcgcggct
gtggagcttgtgcaggagatgtccatggcgccttcggccctctcctgcgccgtgatcgat
gaatggctgtcgcacggcgtggtcgcttccctgcaggccgacctgcgccatgaggcacag
cggcgctgccggctggccgcatcacaccttgcctcgcacctgagtggctccggcctggtg
ctgcaccccgaggcctacaacgcctggctgcccatggagcgcgaagccgccggccgcctg
gtatcggccgcagcggcgctgggcttgaagctgaccgatccgggctcgctcatggtggac
ccgcaggagcaggccagcgggctgcgcatctgcctgggtgcgccgcgtttcgacgcgctg
gacggcgccctggcgcagttggcccggctgcttactgcggtgccctga

DBGET integrated database retrieval system