KEGG   Delftia acidovorans: Daci_5892Help
Entry
Daci_5892         CDS       T00620                                 

Definition
(GenBank) TonB-dependent siderophore receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5892
Transporters [BR:dac02000]
 Other Transporters
  Pores ion channels [TC:1]
   Daci_5892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug STN
Motif
Other DBs
NCBI-ProteinID: ABX38520
UniProt: A9C157
Position
6549317..6551848
Genome map
AA seq 843 aa AA seqDB search
MHSPSSTAGPRASLRATALAALAVSTSLLLHALPVQAAEPAASAAARSYQIQPGPLGPAL
MAFAAQAGVNLGMDLQQLGGMETRGLSGTFSVEDGFAQLLNTSGWTARRVGAGNYALEKL
PAAARQAPSTAAAVPSPSAPAAAPAAAQATELAAITVTARTQNNLVAPSRQVTILEGQEV
EQLRQGSDSLATMLSKVVPGMADSSHTITDYGQTLRGRNMLVLVDGVPLNTNRDSSRNLA
NINPADIEQIEVLRGSSAIYGSGAAGGIVSIRTKRPSGETRAETIVTGSAPLSRLRGAGL
GGEVQHYLSGGGEVVDYSVSLGAKHMGGAFDAKGNRIAPEPSQGDLFDSSIYNASAKIGF
KLDADQRLQLTASHYNAAQDTDYASDPAVARLPAGTAAARPIKGLVLADQNQIRNTMLGL
DYENRDIAGSTLAAQLYYRDFFTRFAPFDARAVPVRGANVDQSMQNSEVFGGRLTLKTPL
GASKKSLLIWGADFHQERTDMPIDIFDPRAYDASGGLVFNKTGRLVYMPPVTTRSIGAFA
QLQHQFSDQWSAEGGLRYDRAQASFNDFTPLSQSRVPNPQSVNGGTVQYNAWTYNLGTVF
TPVKGQEFYASYSQGFELPDIGVVVRNATPAFNLGNSNLQAVKTNTYEMGWRGKFSNVMA
NLSVFQSRSNLGAVQSFNNGLSLLRTREKIHGLEGGLDYFSDDDHWSAGGSFTWMKGREL
PQAASGYQDMTGFRIPPLKLTAYVEYRPDARWSHRLQATSYAAKDYRLDGKTGFGRYDTR
GYTTVDLISQWKIDPKNRVSLGVENLFNRQYFPLYSQLLRSNNNTSRLPAAGTVLKISYA
HTW
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgcactccccttcttccaccgccggaccacgcgccagcctgcgcgccaccgccttggcg
gccctggccgtcagcacctcgctgctgctgcacgcgctgccagtccaggcggccgagccg
gccgccagcgccgctgcccggagctaccagatccagccgggtccgctgggcccggcgctg
atggcctttgccgcacaggcaggcgtgaacctgggcatggatctgcagcagctcggcggc
atggagacacgcggcctgtccggcacgttctccgtggaggacggctttgcgcagctgctg
aacacgtcaggctggacagcgcgccgcgtgggtgcgggcaactacgcgctggagaagctg
cctgcggcggcccgccaggcgccgtccactgcagcggccgtgccctcaccctcagccccg
gccgcagccccagccgcggcacaggccacggaacttgccgccatcacggtgaccgcgcgc
acgcagaacaacctggtcgcgccctcgcggcaagtgacgattctggaaggccaggaggtg
gagcagctgcgccagggctcggacagcctggccaccatgctcagcaaggtggtgcctggc
atggcagactccagccacaccatcaccgactacggccagacgctgcgcggccgcaacatg
ctggtgctggtggacggcgttccgctgaacaccaaccgcgactcgtccaggaacctggcc
aacatcaacccggccgacatcgagcagatcgaggtgctgcgcggcagcagcgccatctac
ggcagcggtgcggcgggcggcattgtctccatccgcaccaagcggccctctggcgagacg
cgggccgagaccatcgtcaccggctcggcccccctgtcgcgcctgcgcggcgcggggctg
ggcggcgaggtgcagcactacctgtccggcggcggcgaggtggtcgactactcggtgagc
ctgggcgccaagcacatgggaggcgccttcgacgccaagggcaaccgcattgcgcccgag
cccagccagggcgacctgttcgattccagcatctacaacgcgtcggccaagatcggcttc
aagctcgatgccgaccagcgcctgcaattgaccgccagccactacaacgcggcccaggac
acggactacgcctccgacccggcggtggcgcggctgccggccggaacggccgcagcccgc
cccatcaagggcctggtgctggccgaccagaaccagatccggaacaccatgctggggctg
gactacgagaaccgggacatcgcaggcagcacgctggccgcccagctctactaccgggat
ttcttcacgcggtttgcgcccttcgacgcacgcgccgtgccggtgcggggcgccaatgtc
gatcagtccatgcagaactccgaggtctttggcgggcgcctgacactgaagacgccgctg
ggcgccagcaagaaaagcctgctgatctggggtgcggacttccaccaggagcgcaccgac
atgcccatcgacatcttcgacccccgggcctatgacgccagcggcggcctggtcttcaac
aagaccggccgcctggtctacatgcccccggtcaccacgcgcagcatcggcgccttcgcc
cagctgcagcaccagttcagcgaccaatggtcggccgaaggcggcctgcgctacgaccgc
gcccaggccagcttcaacgacttcacgccgctgtcgcaatcgcgggtgcccaacccccag
tccgtgaatggcggcaccgtccagtacaacgcctggacctacaacctgggcacggtcttc
acgccggtgaagggccaggagttctatgcctcgtacagccagggcttcgagctgccggac
atcggcgtggtggtgcgcaatgccacgccggccttcaacctgggcaactccaacctgcag
gcggtcaagaccaacacctatgaaatgggctggcgcggcaagttctccaacgtgatggcc
aatctcagcgtcttccagtcgcgctccaacctgggcgccgtgcaaagcttcaacaacggc
ctgtccctgctgcgcacccgcgagaagatccacggcctcgaaggcggcctggactacttc
agcgatgacgaccactggagcgcgggcggcagcttcacctggatgaagggccgcgagctg
ccccaggccgccagcggctaccaggacatgacgggctttcgcatcccgccgcttaagctg
acggcctatgtggagtaccggcccgatgcccgctggagccaccgcctgcaggcaacctcg
tatgccgccaaggactaccgcctggacggcaagaccggctttggccgctatgacacgcgg
ggctacaccacggtggacctgatcagccagtggaagatcgaccccaagaaccgcgtgtcc
ctgggcgtggaaaacctgttcaaccgccagtacttcccgctctacagccagctgctgcgc
agcaacaacaacaccagccgcctgccagcggccggcacggtgctgaagatcagctacgcg
cacacctggtga

DBGET integrated database retrieval system