KEGG   Delftia acidovorans: Daci_5893Help
Entry
Daci_5893         CDS       T00620                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dac03021]
    Daci_5893
Transcription machinery [BR:dac03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Daci_5893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 HTH_23 Sigma70_ECF GerE HTH_40 HTH_11 HTH_20 HTH_Tnp_ISL3 HTH_3 HTH_Tnp_4 DUF1804 HTH_38 HTH_29 HTH_24
Motif
Other DBs
NCBI-ProteinID: ABX38521
UniProt: A9C158
Position
6551986..6552501
Genome map
AA seq 171 aa AA seqDB search
MSSGEFALHNEVQSLYRDHHRWLRDWLRRKLGCSHHAADLAHDTFVRLLGRKERADPVDP
RAYLTTIAHGLVVDFHRRRALERAYLESLAALPEPQAPSPEARAIVLEALVAIDAMLDGM
KPAVRQAFILSQLEGLTYAQIAARLQVTVRTVNNYMLKALEHCYLIVADGA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccggcgaattcgcgctgcacaacgaggtccagtcgctctatcgtgaccatcac
cgatggctgcgcgattggctgcgcagaaaactgggctgctcccaccatgccgccgacctg
gcccacgacaccttcgtgcgcctgctcggccgcaaggagcgggcggacccggtggacccc
cgcgcctacctgaccaccatcgcccacggcctggtggtggactttcaccggcgccgggcg
ctggagcgggcctatctggaatcactggccgccctgcccgagccgcaggcgccttcgccc
gaggcgcgggccatcgtgctggaggccctggtggccatcgacgccatgctcgacggcatg
aagcccgccgtgcgccaggccttcatcctctcgcagctcgaaggcctgacctatgcgcag
atcgccgcccggctgcaggtgaccgtgcgcaccgtcaacaactacatgctcaaggcgctg
gagcactgctacctcatcgtggcagacggcgcatga

DBGET integrated database retrieval system