KEGG   Desulfofarcimen acetoxidans: Dtox_0291Help
Entry
Dtox_0291         CDS       T00986                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dae  Desulfofarcimen acetoxidans
Pathway
dae03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dae00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dtox_0291
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dae03011]
    Dtox_0291
Ribosome [BR:dae03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Dtox_0291
  Bacteria
    Dtox_0291
  Archaea
    Dtox_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF1173
Motif
Other DBs
NCBI-ProteinID: ACV61244
UniProt: C8W3Z0
Position
316009..316350
Genome map
AA seq 113 aa AA seqDB search
MEARAVAKYIRIAPRKVRQVVDLIRGKQVAEALAILKYIPNRGSVAVAKVVKSASANAEH
NNDANKDNLYVAEAFVDQGPTLKRFNPRAMGRADLKRRKTSHITIVVREKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagagctgttgccaaatatatcagaatcgccccgcggaaagtgcgccaggtc
gttgatttgattcgtggcaaacaggtagcggaagccttggcaattttaaagtatattcct
aaccggggttcagtggcggtggcaaaggttgtaaagtctgcgtcagccaatgctgagcat
aataatgatgcaaataaagataacctctatgtagccgaagctttcgtggatcaaggtccg
acattaaagcgttttaatcctagagctatgggaagagcggatctgaagcgcaggaaaacc
agccacataacaattgtggtaagggaaaagaaggagggataa

DBGET integrated database retrieval system