KEGG   Desulfotomaculum acetoxidans: Dtox_1034Help
Entry
Dtox_1034         CDS       T00986                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
dae00250  Alanine, aspartate and glutamate metabolism
dae01100  Metabolic pathways
dae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dtox_1034
Enzymes [BR:dae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dtox_1034
Peptidases [BR:dae01002]
 Cysteine Peptidases
  Family C44
   Dtox_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: ACV61920
UniProt: C8W452
Position
complement(1056509..1058353)
Genome map
AA seq 614 aa AA seqDB search
MCGITGWIDWSEDLTKQKHVLEVMSETLAKRGPDDKGYWFSTCAALAHRRLIVIDPEGGA
QPMSRRYCQHEYVIIYNGELYNTPELRRELESRGHIFQSHSDTEALLLSYIEWGTGCVDY
LNGIYAFAVWNEAEQSLFMARDRMGVKPLFYTRKGNALIFGSELKALLTHPAIKAEVNSE
GLAEIFVMGPARTPGHGVFRNIYELKPGYFLIYNQAGLYTHKYWSLQSLPHDDDFETTTG
KVRSMVIDSIERQLVSDVPVCTLLSGGLDSSAITAVASAAFKQSSLGKLNTYSVDYVGND
QHFRPSHFQPNSDSHWVYRMSRQFNTNHHNIELETIELVNSLEQAMLARDLPGMADVDSS
LLLFCQAIKKEATVALSGECADEVFGGYPWFHNQEAINATTFPWSRSLKDRMSIFSPELL
ELMKPEEYISDRYQETLAKTPVLPGEEPLEARLREICYLNITWFMTTLLDRKDRMSMATG
LEVRVPFCDHRLVEYVWNIPWAIKNHGNREKGLLRRALTGILPGDVLERRKSPYPKTHNP
AYTAAVRSKLLQILDDANSPLLPLININAIRKLAQQEGDAFDRPWFGQLMTGPQLFAYLI
QVNSWLKEYKISIC
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaataacaggctggatagattggtcggaggatcttacaaaacagaaacatgta
ttggaggtaatgtcggaaacactggccaaacggggaccggacgacaagggttactggttt
tcaacttgtgcggcactggcgcaccgcaggctgattgtcatagatccggaaggcggcgct
caaccaatgtcccgccgttactgccaacacgaatacgtcataatatataacggggaactt
tataatacacctgaattgaggcgggaattagaaagcagggggcatatctttcagagccac
tcggatacggaggctcttttactgtcatacatcgagtggggtacaggctgcgttgattac
ctgaacggcatttatgccttcgccgtttggaatgaagccgagcaaagtttatttatggca
cgtgatagaatgggagtaaagcctctgttttacacccgcaagggaaacgcacttatattt
ggctccgagctaaaagccctattaacccacccggccatcaaagcggaggtgaacagcgag
gggttggccgaaattttcgttatgggaccggccagaacacccgggcacggtgtttttcgc
aatatttatgaacttaaacccggttattttttaatctataaccaagcaggtctatacaca
cataaatactggtcactgcaaagcctacctcacgatgatgactttgaaaccacaaccggc
aaagttcgctcaatggtaattgacagcattgaaagacagctggtttccgatgttcctgtt
tgcacactgttgtcgggaggattagactccagcgccataaccgccgttgcttcagctgct
ttcaaacaatcctcattaggaaagctcaacacttactccgttgactatgttggcaatgat
cagcacttccgtcccagtcattttcaacctaattccgatagtcactgggtatacaggatg
tcccggcaatttaacacaaaccatcataatattgaattagagactatagaattagtaaat
tcgctggaacaagccatgctggccagggatttaccgggtatggcagatgttgattcttct
ttgctcttattctgccaggcaattaaaaaggaagctacagtagcgctatcaggtgagtgc
gcggatgaagtattcggagggtatccctggtttcataaccaggaggctattaacgccact
acctttccctggtccagatcccttaaagatcgtatgagtatattctccccggaactgctg
gaattaatgaaaccggaagaatacatttctgacaggtatcaggaaacactggccaaaaca
ccggtactgccaggtgaagaacctctggaagccaggttacgcgaaatatgttacctgaat
atcacctggtttatgactaccttgcttgaccgcaaggaccgcatgagcatggccacggga
ttggaagtccgagtacctttctgcgatcatcgtttagtagaatatgtctggaatattcca
tgggctataaaaaaccacggtaatagagaaaaaggacttttgcgcagggctcttaccgga
attttgcccggtgatgtgctggaaaggcgtaaaagcccttatcccaaaacccacaacccg
gcttatacggcagctgtacgaagcaaactgctgcaaatactggatgacgcaaactcacct
ttgctgccattaatcaatataaatgccatacgcaagctggctcagcaagaaggagatgca
tttgacaggccctggttcggccagcttatgaccgggccgcagctttttgcctatttgata
caggtaaattcttggttgaaagagtacaaaatcagtatttgctaa

DBGET integrated database retrieval system