KEGG   Desulfotomaculum acetoxidans: Dtox_1363Help
Entry
Dtox_1363         CDS       T00986                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
dae00790  Folate biosynthesis
dae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dtox_1363
Enzymes [BR:dae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dtox_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACV62239
UniProt: C8W6F0
Position
1394284..1394850
Genome map
AA seq 188 aa AA seqDB search
MIDQEKIEKAVYMILEAIGEDPEREGLLETPARVARMYKEVFCGLSEDPNIHLRKIFNEE
HEELVLVKDIAFSSMCEHHLLPFFGKAHVAYIPHKGRVTGLSKLARVVDSYAKRPQLQER
LTSQIADCIMKHLNPYGVIVVVEAEHMCMTLRGIKKPGSKTVTSAVRGAFKSNDATRAEA
FALIRTLN
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccaagaaaagattgaaaaggctgtatatatgatcttagaagctattggtgaa
gatcccgaaagagaaggtctattagaaacccccgcccgggttgccagaatgtataaagaa
gttttttgcggtttatctgaggatcctaatatacacttgcgaaaaatttttaatgaggag
cacgaggaattggttttagttaaagacatagcattttcctctatgtgtgagcaccacctc
cttcctttttttggcaaggcacatgttgcttatattccgcataaaggtagagtgaccggt
ctgtctaagctggcccgtgtagtagattcctatgccaaaaggccacaattgcaggaacgc
ttgacttcacaaattgctgattgtataatgaagcatttaaatccttacggagttatagtt
gttgttgaggctgagcatatgtgtatgaccttgcgtggtattaaaaaacccggctcaaaa
actgttacatctgctgtgcgtggtgcttttaaaagcaacgatgctaccagagcagaggcc
tttgcattaatcagaacattaaattag

DBGET integrated database retrieval system