KEGG   Desulfovibrio africanus: Desaf_0287Help
Entry
Desaf_0287        CDS       T01662                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase NAD-binding protein
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
daf  Desulfovibrio africanus
Pathway
daf00030  Pentose phosphate pathway
daf00480  Glutathione metabolism
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
daf01120  Microbial metabolism in diverse environments
daf01130  Biosynthesis of antibiotics
daf01200  Carbon metabolism
Module
daf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
daf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:daf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desaf_0287
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Desaf_0287
Enzymes [BR:daf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     Desaf_0287
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     Desaf_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 F420_oxidored TLP1_add_C adh_short
Motif
Other DBs
NCBI-ProteinID: EGJ48645
UniProt: F3YU39
Position
complement(308778..309488)
Genome map
AA seq 236 aa AA seqDB search
MHVAVMTGGLESEDLARRLLKAGHRVLACALDDEALERLAHHGRIERASLESVPAKLSRP
RVLWFATTPAREFDAALDKLEGSLAKDDTLVDSGNTFYEDDLCRAKRLERRGAFLLDAGV
FKEGYRLSFAVGGDFAAFEFLRPLFESLAFRGGVCHCGGPGAGHFVRSLHERTEHLLRMA
YHDARECIEASPYKVDLGFSEFLLFTQRYCKGQPCADLPLEGLAAMAAPSVTSRPD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttgcggtcatgaccggcggcttggagagcgaggatctcgcgcgcaggctgctc
aaggcaggccatcgcgtgctcgcctgcgctctggacgacgaggccctggagaggttggcc
caccatggaaggatcgaacgagcatccttggaaagcgtgccggccaaactatcgcggccc
cgtgtgctctggttcgccacgacgcctgcccgcgaattcgatgcggctttggacaagctg
gaaggctccttggccaaggacgacacgctcgtggatagtggcaacaccttttacgaggac
gatctgtgcagggccaaacgccttgagcgcaggggggcattcctgctcgatgcgggagtt
ttcaaggagggctaccgtctttcctttgcagtgggtggtgactttgccgccttcgagttc
ctgcgtcccctattcgaaagtctggctttccgggggggcgtctgccattgcggcgggcca
ggagcagggcatttcgtgcgcagcctgcacgagcgtaccgagcacctcttgcgcatggcc
taccacgatgcccgagagtgcatagaggcctcgccatataaggtcgacctgggtttttcc
gagttccttttgttcacgcagcgctactgcaaggggcagccatgtgctgacctgcctctg
gagggacttgccgccatggctgcgcccagtgttactagcaggcctgactaa

DBGET integrated database retrieval system