KEGG   Desulfovibrio africanus: Desaf_1719Help
Entry
Desaf_1719        CDS       T01662                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
daf  Desulfovibrio africanus
Pathway
daf00620  Pyruvate metabolism
daf00630  Glyoxylate and dicarboxylate metabolism
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
daf01120  Microbial metabolism in diverse environments
daf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desaf_1719
   00630 Glyoxylate and dicarboxylate metabolism
    Desaf_1719
Enzymes [BR:daf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Desaf_1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: EGJ50055
UniProt: F3Z1U7
Position
complement(1916458..1918629)
Genome map
AA seq 723 aa AA seqDB search
MSQRVQAGRLAVSKPLHDTIAAIAPGTGISADAFWSALEQIVVDMGPRSRELLNKRQVLQ
DKIDAWHREHKAHDHAAYKKFLLDIGYLVPEGDNFSITTANVDDEIARIAGPQLVVPITN
ERYALNAANSRWGSLYDALYGTDVISQEGEAKRGYDPERGKQVMRRAGEFLDASAPLAMG
SHAQAVRYGLEDAGGRKSLVVELQGGERVGLKKSEQFAGYVGGSEPSLILLVNHGLHIEL
HIDRKDTIGKDHPAGIKDVVLEAALTTILDCEDSVAVVDGADKAQAYRNLLGLFRGDLQA
RFEKGGSFVTRTLQPDRTYTAPDGSALTLHGRSLMLVRTVGLLMTTPAVLLDNKEIPENM
LDTLATAFIGQHDIKGTGPLKNSRAGSVYMVRPKMHGPEEVAFACELFTRVEQALGIAKG
TLKIGVMDEERRTSVNLKECIRQAKERIIFINTGFLDRTGDEIHTDMEAGPMVRKNDMKA
QPWMPAYEDLNVDVGLEAGFSGKAQVGKGMWAKPDRMREMLETKIGHPQSGANCAWVPSP
TAATLHATHYHQVDVFARQKELAGKRRGSLDDLLTLPVMKDDRPSAKDVQEELDLNAQSI
LGYVVRWVEQGIGCSKVPDLTNVGLMEDRATLRISSQAIANWLHHGICTKEQVLETLKRM
AKVVDGQNAGDAMYRPMAKDYEGSVAFQAACDLVFKGREQPSGYTEPILHARRLEAKRKF
GIA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagagtgcaggcaggcaggctcgcagtttccaagccgctccacgacactatc
gccgcaatcgctccgggaaccggcatctcggcggacgcgttctggagcgccctggagcaa
atcgtcgtcgacatgggaccgcgcagcagggagctgctgaacaaacggcaggttttgcag
gacaagatcgacgcctggcaccgggagcacaaggcccacgaccacgcggcctacaagaaa
ttcctcctggacatcggatacctggtgcccgagggcgacaacttcagcatcaccacggcc
aacgtcgatgacgagatcgcccgcattgccgggccgcagctagtggtgcccatcaccaac
gaacgctacgccctcaacgcggccaactcccgctggggcagcctgtacgacgcgctgtac
ggcacggacgtcatctcgcaggaaggcgaggccaagcgcggctatgatcccgagcgcggc
aagcaggtcatgcgccgcgcaggcgagttcctggatgcgtccgcgccgctggccatgggc
agccatgcccaggccgtgcgctacggcctggaggacgcaggcggccgcaaaagcctcgtt
gtcgaattgcagggcggcgagcgcgtgggcctgaagaagtcggagcagttcgccggttat
gtgggcgggagcgagccgtcgctcatcctgctcgtgaaccacggcctgcatatcgagctg
cacatcgaccgcaaggacaccatcggcaaggaccatccggccgggatcaaggacgtggtg
ctggaagcggctctgaccaccatcctggactgcgaggactccgtggccgtggtggacggc
gcggacaaggcccaggcctaccgcaacctcctcgggctgtttcggggcgatttgcaggcg
cgcttcgagaagggcggctcattcgttacgcgcaccctgcagccggaccgcacctacacc
gcgcccgacggctccgcgctgaccctgcacggccgcagcctcatgctcgtgcgcacggtc
ggcctgctcatgaccacgcccgccgtgctcctagacaacaaggaaatccccgagaacatg
ctcgacacgctggccacggcctttatcggccagcacgacatcaagggcacgggcccgctc
aagaacagccgcgcgggcagcgtgtacatggtccggcccaagatgcacggccccgaggag
gttgcctttgcctgcgagctgttcacgcgcgtggagcaggccctgggcatcgccaaaggc
accctcaagatcggcgtcatggatgaggagcggcgcacctcggtcaacctcaaggagtgc
atccgccaggccaaggagcgcatcatcttcatcaacaccggcttcctggaccgcacgggc
gacgagatccacacagacatggaggccgggcccatggtgcgcaagaacgacatgaaggcc
cagccgtggatgccggcgtatgaagacctgaacgtggacgtcggcctggaggcgggcttc
tcgggcaaggcccaggtcggcaagggcatgtgggccaagcccgaccgcatgcgcgagatg
ctggagaccaagatcggtcacccgcagtccggcgcaaactgtgcctgggtgccctcgccc
accgccgccacgctgcacgccacgcactaccatcaggtggacgtgttcgcgcgccagaag
gagctggccggcaagcgccggggcagccttgacgacctgctgaccctgccggtcatgaag
gacgacaggccgtcggccaaggacgtgcaggaagagctggacctcaacgcgcagtccatc
ctgggctacgtcgtgcgctgggtcgagcagggcatcggctgctccaaggtgccggacctg
accaacgtgggcctcatggaggaccgcgccacgctaaggatttcaagccaggccatcgcc
aactggctgcaccatggaatctgcacgaaagagcaggtgctggagacgctcaagcgcatg
gccaaggtcgtggacgggcagaacgcgggggatgcgatgtaccggcccatggccaaggat
tatgagggtagcgtggcgttccaggcggcgtgcgatctggtttttaaaggcagagagcag
ccgagcggatataccgagccgatattgcatgcgaggcggttggaggcgaagaggaagttt
gggatagcgtag

DBGET integrated database retrieval system