KEGG   Desulfovibrio africanus: Desaf_1776Help
Entry
Desaf_1776        CDS       T01662                                 

Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
daf  Desulfovibrio africanus
Pathway
daf00860  Porphyrin and chlorophyll metabolism
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
daf01120  Microbial metabolism in diverse environments
Module
daf_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:daf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desaf_1776
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:daf01007]
    Desaf_1776
Enzymes [BR:daf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Desaf_1776
Amino acid related enzymes [BR:daf01007]
 Aminotransferase (transaminase)
  Class III
   Desaf_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF1589
Motif
Other DBs
NCBI-ProteinID: EGJ50112
UniProt: F3Z204
Position
complement(1982680..1983951)
Genome map
AA seq 423 aa AA seqDB search
MSLSETLFQEAQKYIPGGVNSPVRACKSVDATPLFIKKAEGSRITSVEGASYIDYVLSWG
PMILGHAHPDVTEVAVAAAKKGASYGAPCEAEIDLARAVCHALPTVEMVRMVNSGTEATM
SALRLARGYTGRNKVLKFIGGYHGHGDPFLASAGSGVATLAIPGTPGVPADVVAHTLLAQ
YNDLEQVKAHFERHGDDIACIIVEPVAGNMGLVLPKPGFLEGLREITRQYGALLIFDEVI
TGFRVDFGGAQKRFGIQPDLTCLGKIIGGGFPVGAYGGRRDIMQRVAPCGDVYQAGTLSG
NPVAMAAGTCTLELLSRADYAGLEQRTQALVAELKSIFAEKSVPVVINQIASIFTIFFTQ
TPEIVDFPTASTADSARYTRFYAHMREKGVYLAPSGYECAFLSFAHSDRDINITLEAVRS
AQL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagcctatctgaaactctcttccaggaagcccagaagtacataccgggcggggtcaac
agccccgtgcgggcctgcaagtccgtggacgccacgcccctgttcatcaaaaaggccgaa
ggctccaggatcaccagcgtggagggcgcatcctacatcgactacgtgctctcctggggt
cccatgatcctgggccacgcccatccggacgtgaccgaagtggccgtggccgccgccaag
aagggcgccagctacggcgcgccctgcgaggccgagatcgacctggctagggccgtctgc
catgccctgcccacggtggagatggtgcgcatggtcaactccggcaccgaggccaccatg
agcgccctgcgcctagcccgcggctacaccggccgcaacaaggtgctcaaattcatcggc
ggctatcacggccacggcgatccgttcctggcgtcggccggctcgggcgttgccaccctg
gccattcccggcacgcccggcgtgcccgccgacgtagtggcccacacgctgctcgcgcag
tacaacgacctggagcaggtcaaggcccatttcgagcgtcacggcgatgacatcgcctgc
atcattgtggagcccgtggccggcaacatgggactggtgctgcccaaacccggctttctg
gaagggctgcgcgagatcacccgccagtacggcgcgctgctcattttcgacgaggtaatc
accggcttccgtgtggatttcggcggagcccaaaagcgcttcggcatccagcccgacctg
acctgcctgggcaagatcatcggcggcggcttccccgtgggggcctacggcggacggcgc
gatatcatgcagcgcgtcgcgccctgcggagacgtgtaccaggccggcaccctgtccggt
aaccccgtggccatggccgccggcacctgtaccctggaactgctctcccgcgccgattac
gcggggctggagcagcgcacccaggccctggtggcggaactgaagtccatattcgcggaa
aagtccgtgcccgtggtcatcaaccagatcgcctcgatcttcaccatcttctttacccag
acacccgagatcgtggacttccccacggccagcacggccgactcggcgcgttacacccgc
ttctacgcgcacatgcgcgagaaaggcgtgtacctcgcgccgtcaggctacgagtgcgcc
ttcctgtccttcgcgcacagcgatcgcgacatcaacataactctggaagcggtgcgctcg
gcgcagttgtag

DBGET integrated database retrieval system