KEGG   Desulfovibrio africanus: Desaf_1870Help
Entry
Desaf_1870        CDS       T01662                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
daf  Desulfovibrio africanus
Pathway
daf00260  Glycine, serine and threonine metabolism
daf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
daf01130  Biosynthesis of antibiotics
daf01230  Biosynthesis of amino acids
Module
daf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaf_1870
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desaf_1870
Enzymes [BR:daf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desaf_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA DUF3017 Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: EGJ50201
UniProt: F3Z2N4
Position
complement(2091807..2092583)
Genome map
AA seq 258 aa AA seqDB search
MTTLTKSRLEQKIREANEAGRKALIPYLPAGYPDKERFWRELSALDKSGADIIEIGVPFS
DPVADGPVVERASLQCLEAGITLDWILAELKKRKGGFKAGIVLMGYYNPFYKYGLDRLAA
DAAEAGVTGFIVPDLPMEESEDMTKALAARGLDLIPLVGLNTNEERMKLYADNARGYVYF
VSVLGTTGERTSLPEEIAGRLAVAKRVFDVPLALGFGISRPEQLTTFGDTIDAVVFGSSL
IKHLDQGGDSAGFMARWK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactgacgaaatccaggctggagcaaaagatacgcgaggccaacgaggccggc
cgcaaggcgctcattccctacctgccggcgggctacccggataaggagcgtttctggagg
gagctttcggccctggacaaaagcggagcagacatcatcgagatcggcgtgcctttctca
gacccagtggccgacggcccggtggtggaacgggcctccctgcagtgccttgaagccggc
atcacgctggattggattctggccgagctgaagaaacgcaagggcggcttcaaggccggg
atcgtgctcatgggctactacaacccgttctataaatacggcctggacaggctggcggcc
gacgcagccgaggccggagtgaccggcttcatcgtgcccgacctgcccatggaagagtca
gaggacatgaccaaggcgctggcggcccgcggtctggacctcattccgctcgtgggcctg
aacacgaacgaggagcgcatgaagctctacgccgacaatgcgcggggctacgtctatttc
gtgtccgtgctgggcaccacgggcgaacgcacgagcctgcccgaggaaatcgccggtcgg
ctggccgtggctaagcgcgtattcgacgtgcccctggccctaggcttcggcatctccagg
cccgagcagctgaccaccttcggcgacacgatcgacgccgtggtcttcggcagctcgctc
atcaagcatctggaccagggcggcgactcggccggcttcatggcccgctggaagtag

DBGET integrated database retrieval system