KEGG   Desulfovibrio africanus: Desaf_1984Help
Entry
Desaf_1984        CDS       T01662                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
daf  Desulfovibrio africanus
Pathway
daf00330  Arginine and proline metabolism
daf00332  Carbapenem biosynthesis
daf01100  Metabolic pathways
daf01130  Biosynthesis of antibiotics
daf01230  Biosynthesis of amino acids
Module
daf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desaf_1984
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Desaf_1984
Enzymes [BR:daf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desaf_1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: EGJ50313
UniProt: F3Z369
Position
2201937..2202959
Genome map
AA seq 340 aa AA seqDB search
MQDWREHKRTVLENAKRVLVKVGSAVLTDEHGLNLRVVNRLTDQIASLHDRGQDVILVTS
GAVAAGRQALLACPPCGKDIFGLPAKQAAASIGQSRLMHEYDEAFARCGKTTAQILLTRD
DFQSRQRFLNARNTLTTLLEWRVIPIINENDSVAVAELAFGDNDALASMVLGLVDADLFV
NLTSATGVFEANPSENPKACRLECIQEIAHLDVEAMCHGKTTVGSGGMYSKLLAAKRAAQ
LAVPTLIVSGKERYALEKAMAGEDMGTWIMPEAQAIPSRKFWLAYHDWQGQTIGVGVTNY
AAQDLKKIMGRRTGSIEELLGPGLYPEVVHRDNMLLDPAL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattggcgcgagcacaagcgtacggtgttggagaatgcgaaacgagtgcttgtg
aaagtgggcagcgcggtgctcacggatgagcacggcctgaacctgcgggtggtcaaccgc
ctgacggaccagatcgcctcgctgcacgaccgggggcaggacgtcatcctggtcacctcg
ggcgcggttgccgccggtcggcaagctttgctggcttgtcccccctgcggcaaggacatt
tttgggctaccggccaagcaggccgcggcctccatcggccagagccggctcatgcacgaa
tacgatgaggccttcgcccgctgcggcaagaccactgcccagatcctgcttacccgcgac
gactttcagagtcgccagcgtttcctcaacgctcgcaacaccttgaccaccctcttggag
tggcgggtaatccccatcatcaacgaaaacgattctgtggccgtggccgagttggctttc
ggcgacaacgacgccctggccagcatggtcctggggcttgtggacgcggatttgttcgtc
aatctgacctcggccaccggcgtgttcgaggccaacccatccgagaatcccaaggcttgc
cgactggagtgcatccaggagatcgcgcaccttgacgtcgaagccatgtgtcatggcaag
accacggtcggcagcggcggcatgtactccaagctgctggccgccaagcgcgcggcgcaa
ctggccgttcccacgctcatcgtttcgggcaaggagcgctatgcgctggagaaggccatg
gccggcgaggacatgggcacttggatcatgcccgaggcgcaggctattcctagccgcaag
ttttggctggcctaccatgattggcagggccagacgatcggcgtcggcgtgaccaactac
gcggcccaggacctcaagaaaatcatgggccgccgcacgggctcgatcgaggaattgctt
ggacccggcctgtaccctgaggtcgtgcaccgcgacaacatgctgctggatccggcgttg
tag

DBGET integrated database retrieval system