KEGG   Desulfocurvibacter africanus subsp. africanus: Desaf_2236
Entry
Desaf_2236        CDS       T01662                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
daf  Desulfocurvibacter africanus subsp. africanus
Brite
KEGG Orthology (KO) [BR:daf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:daf02044]
    Desaf_2236
Secretion system [BR:daf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Desaf_2236
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: EGJ50563
UniProt: F3YWS0
Position
2477035..2478423
AA seq 462 aa
MRTDRPILWQQGQFLQPQHFQLLDRYHESLLNPLRQYLRPYFWGVISLEIHEAALSNARF
ELSKGEFLFPDGELVSYPGNALLRPRSFEAEWTDFQRPFKVYLGLRRQDSQDGNVEVIDG
PDGLADMPKRYTSRSGPEEAGDQYGQGPVAQVRFLNYGLRLFWESELERAQNYSLLPIAS
LERDGGEVRVCRRYIPPCLTLSACGLLREMVRGLKDQLVSRCRQLEEYKSPREVQVSALD
AGYFVFLLALRSLNRYLPQLCHLLEAPHIHPWDVYGVLRQLAGEMSTFSEDLNALGERRD
STLAVPQYDHGDLWRCFSELSVLVEQLFSSISVGPEHTVRLEPEGSYLSASFEPRHFQES
NSYWLVLHTSTSPEEVLESVRNMAKLSAAAKITTLVAMAVPGVPLHYFPVPPPGLPRRAK
SFYFRIDHESPQWGEVQRTRRVSLYWDSKPEDLAGEIVILRN
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgcgtacagacaggcccatcctttggcagcagggacagtttctccagcctcagcacttc
cagctcctggatcgctatcatgaatcgctgctgaaccccctgcggcagtacctgcgtccc
tacttctggggtgtcatttccctggaaatccacgaggcagccctgagcaacgccaggttc
gagctgagcaagggggagttcctgttccctgacggcgaactggtgtcttatccgggcaac
gccctgctgcggccgcgatccttcgaggccgagtggaccgatttccagcggcccttcaag
gtctaccttggcctgcgcaggcaggatagccaggacggcaacgtcgaggtcatcgatggc
ccggacgggctggccgacatgccgaagcgctacacctcccgctccggaccggaagaggcc
ggcgaccagtatggccagggcccggtggcccaggtgcgcttcctgaattacgggctcagg
ctcttctgggagtcggagcttgagcgggcccagaactatagtctgctgcccatcgccagc
ctggagcgcgacggcggtgaggtccgggtctgcaggcgctacattccaccgtgcctgacc
ctgtcagcctgcggcctgctcagggagatggtgcgcggcctcaaggaccagctcgtttcg
cgctgccgccagctcgaggagtacaagagcccgcgcgaggtgcaggtcagcgccctggat
gcgggttatttcgtgttcctgctggccctgcgctccctgaacaggtatttgccgcagctc
tgccatctgctcgaagcgccgcatattcatccctgggacgtgtacggggtcctgcgtcag
ctcgcaggggaaatgagcaccttttccgaggacctgaacgcccttggcgagcgcagggat
tccaccctggccgttccgcaatacgaccacggagacctttggcgctgcttctccgagttg
agcgtgctcgtcgagcagctgttcagctccatcagcgtgggtccggaacacaccgtccgc
ctggagcccgagggcagctacctgagcgcctccttcgagccgcgccacttccaggagagc
aactcctactggctcgtcctgcacacctcgacctcgccggaggaggtcctggagtccgtg
cgcaacatggccaagctctcggctgcggccaagatcaccacccttgtggccatggccgtg
ccgggcgtgcccctgcactatttcccggtgccgccgccgggtctgcccaggcgggccaag
tccttctatttccggatcgaccatgagagcccccagtggggcgaagtccagagaacgcgc
cgggtgtcgctttactgggactccaagccagaggacctggccggcgaaatcgtcatcctg
aggaattaa

DBGET integrated database retrieval system