KEGG   Desulfocurvibacter africanus subsp. africanus: Desaf_2240
Entry
Desaf_2240        CDS       T01662                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
daf  Desulfocurvibacter africanus subsp. africanus
Brite
KEGG Orthology (KO) [BR:daf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:daf02044]
    Desaf_2240
Secretion system [BR:daf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Desaf_2240
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: EGJ50566
UniProt: F3YWS3
Position
2485130..2485612
AA seq 160 aa
MKDGSVAPKERVNITYKPATGSAKEEVELPLKLLVMGDFTQSQDDRPVDQREPVNVGKEN
FQEVLKAQNLGLKLTVPNRLADKEGGQLTLDLKFQSLKDFDPDSIVKNVPELAKLVELRD
ALLALKGPLGNVPEFRKKIQELVSDPGARERLLKELGLEG
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaaagacggttccgtggccccaaaagagcgggtgaacattacctacaagcccgccacg
ggcagtgcgaaggaagaggttgagcttcccctgaagcttttggtcatgggcgacttcact
cagagccaggacgaccgcccggtcgaccagcgcgagcccgtgaacgtgggcaaggaaaat
tttcaggaggtcctcaaggcgcagaacctgggactcaagcttacggtcccgaaccgcctc
gccgacaaggagggcggacagctgaccttggacctcaagttccagagcctcaaggatttt
gatccggacagcattgtcaagaacgtgccggaactggccaagctggtcgaactcagggat
gcgctgttggccctgaagggacccttgggcaacgttcccgagttccgcaagaagattcag
gagctggtttccgatccaggagcgcgcgagcgcctgctcaaggaactgggcctcgaagga
taa

DBGET integrated database retrieval system