KEGG   Desulfovibrio africanus: Desaf_2733Help
Entry
Desaf_2733        CDS       T01662                                 

Definition
(GenBank) Glycyl-tRNA synthetase alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
daf  Desulfovibrio africanus
Pathway
daf00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:daf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desaf_2733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:daf01007]
    Desaf_2733
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:daf03016]
    Desaf_2733
Enzymes [BR:daf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Desaf_2733
Amino acid related enzymes [BR:daf01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Desaf_2733
Transfer RNA biogenesis [BR:daf03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Desaf_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: EGJ51048
UniProt: F3Z0X0
Position
3018094..3018978
Genome map
AA seq 294 aa AA seqDB search
MTFQEVILRLQQFWSDYGCVIGQPFDVEVGAGTFNPHTFFRVIGPEPWKVAYVEPSRRPT
DGRYGENPNRLQHYYQFQVILKPSPDDVQDIYLASLAALGIDTAAHDIRFVEDNWESPTL
GAWGLGWEVWLNGMEVTQFTYFQQTGGIDLHPVSVEITYGLERLCMYLQGKESVYDLDWN
KTVKYGQVHHQNEVEQSKYNFEFSDAGMLFGLFNSYEGECLRLCEVGLPWPAYDYCLKCS
HAFNLLDARGAISITERTGYIGRVRNLASRVARLYATQRKEMGYPLLNTMPTKD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcaggaagtaatcctgcgtctgcagcagttttggtcggattacggctgtgtc
atcgggcagccgttcgatgtcgaggtgggggctggaacattcaacccgcacacgttcttc
cgggtcatcggtcccgagccatggaaagtggcctatgtcgagccctctaggcggcccact
gacggtcgttacggcgagaatcccaaccggctgcagcattactatcaatttcaggtcatc
ctgaagccctcgcccgatgatgtgcaggatatctacctggcgagtctggccgctctgggc
atcgacacggccgcgcacgacatccgcttcgtcgaagacaactgggagtcaccgacattg
ggagcctggggtcttggctgggaagtctggctcaacggcatggaggtgacgcagttcacc
tatttccaacagaccggcggaattgatctgcaccctgtgagcgtagagatcacctacggc
ctggagcgcctctgcatgtatctccagggcaaggagtcggtctacgacctggattggaac
aagaccgtaaagtacggccaagtccaccaccagaacgaggtggagcagtccaagtacaat
ttcgagttctcggatgccggcatgctgttcggattattcaattcctatgagggcgagtgt
ctgcgcctgtgtgaagtgggcctgccttggccggcttacgactactgcctcaagtgctca
cacgccttcaacctgcttgacgcccgtggcgccatatccatcaccgagcgcacgggctac
atcggccgggtgcgcaatctggcgtcccgggtcgcgcgcttgtacgccacccagcgcaag
gaaatgggctatccgctgttgaacacgatgccgaccaaggattga

DBGET integrated database retrieval system