KEGG   Desulfovibrio africanus: Desaf_2739Help
Entry
Desaf_2739        CDS       T01662                                 

Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
daf  Desulfovibrio africanus
Pathway
daf00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:daf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desaf_2739
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:daf01007]
    Desaf_2739
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:daf03016]
    Desaf_2739
   03029 Mitochondrial biogenesis [BR:daf03029]
    Desaf_2739
Enzymes [BR:daf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Desaf_2739
Amino acid related enzymes [BR:daf01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Desaf_2739
Transfer RNA biogenesis [BR:daf03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Desaf_2739
 Prokaryotic Type
   Other AARSs
    Desaf_2739
Mitochondrial biogenesis [BR:daf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Desaf_2739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: EGJ51054
UniProt: F3Z0X6
Position
complement(3023980..3025641)
Genome map
AA seq 553 aa AA seqDB search
MQSMLHLKKLLEEAVTTMGLSLPQGVSLEPPKDIKFGDLATNAAMILAKQAGKPPREVAA
ELRERLLGSHPEIERIEVAGPGFLNFSFAPSFWQSILQDVLEQGDRFGALDVGQKKKVLV
EYVSANPTGPLHLGHGRGAALGDSLVRVLRFAGFDVTTEFYINDAGRQMRLLGMSIWVRY
QQAFNRDVELPEDSYRGEYIKDIAAEIAASHGSELLQVPEAQAMDVCREHGMLSILKWIK
RDLNEFRVSHDIWFSERRLVDTGQVESTIKWLQDKGLAYEQEGALWFNSTRFGDDKDRVL
RRSSGELTYFASDIAYHADKYSRGYDLLVDIWGADHHGYVPRMKAAAQALGKDADQLQVV
LVQMVNILRGGEQISMSKRAGTFETLADVVKEVGVDSARFMFMTRKSDSHLDFDLELVKQ
QSMDNPVYYVQYAHARIRSVFRKAREQGLALQPTVDRSKLMALLDTPEDIQLLKLMEHFP
DAVDAAAKSLSPHHISFFLRELAALLHRYYSVHKVLGAESSQLTLARLLLLDAVAQVLRN
GLQLLGVNAPEQM
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccatgctgcacctgaagaagttgctcgaagaagccgttacgaccatggggctc
agcctgccccaaggagtcagccttgaaccacccaaggacatcaagttcggagatctggcc
actaacgcggccatgatactcgccaagcaagccggcaagcctccccgggaggtggccgcc
gagttgcgtgagcgccttctcggcagccatcccgaaatcgagcgaatcgaggtggctggg
cccggcttcctcaacttttcgtttgcgccctccttttggcagtcgatcctgcaggatgtc
ctggagcaaggcgaccgtttcggggcactggacgtgggccagaaaaagaaagttctagtg
gagtatgtctcggcaaatccgacaggtcccttgcatctcggccatggccgaggagcggcc
ctgggcgacagcctggtccgggtgctgcgctttgccggctttgatgtgaccaccgagttc
tacatcaacgatgcaggccgccaaatgcgcctgctgggcatgtccatctgggtgcgctat
cagcaggcttttaaccgggacgtcgaactcccggaagacagctatcggggcgagtacatc
aaggacatcgccgccgagatcgcggcgagccacggcagcgagctcctgcaggtgcccgaa
gcccaggccatggatgtctgccgcgagcacggcatgctgtccatcctcaaatggatcaag
cgggatctcaatgaattccgggtcagccatgacatctggttctccgaaagacgacttgtg
gacaccggacaggtggagtccacgatcaaatggctccaggacaaggggttggcctacgag
caggaaggcgccctgtggttcaactccacgcgcttcggtgacgacaaggaccgtgtactg
cgccggtcctctggcgagctgacctatttcgcctcggatatcgcctaccacgccgataag
tattctcgcggctacgacctgttggtggatatctggggcgcggaccatcatggctacgtg
ccgcgcatgaaggccgcggcgcaggccttgggcaaggatgccgatcagttgcaggtagtg
ctcgtgcagatggtcaatatcctgcgcggcggcgagcagatctccatgtccaagcgcgcc
ggcacctttgagaccctggccgacgtggtcaaggaagtcggcgtggacagtgcgcgtttc
atgttcatgacgcgcaagagcgacagccatctggacttcgacctggagctggtcaagcag
cagtcaatggacaacccggtatactacgtacaatacgcccatgcacgcatacgctcggtg
ttccgaaaggctcgcgaacagggtctcgctcttcagccgaccgtcgatcggagcaagctg
atggcactgctcgacactcctgaagacatccagctcctcaagctgatggaacacttcccc
gacgcagtggacgccgcagccaagtcgctcagcccgcaccacatcagcttcttcctgcga
gagttggccgcgctcttgcacagatattattcagtgcataaggttctcggtgcggaatcg
tcgcaactcaccctggcgagattactgctgctcgacgcagtggcgcaagtgctcagaaac
gggttgcagctgcttggcgtgaacgctccggaacagatgtag

DBGET integrated database retrieval system