KEGG   Desulfovibrio africanus: Desaf_2764Help
Entry
Desaf_2764        CDS       T01662                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
daf  Desulfovibrio africanus
Pathway
daf00450  Selenocompound metabolism
daf00970  Aminoacyl-tRNA biosynthesis
daf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Desaf_2764
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desaf_2764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:daf01007]
    Desaf_2764
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:daf03016]
    Desaf_2764
Enzymes [BR:daf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Desaf_2764
Amino acid related enzymes [BR:daf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Desaf_2764
Transfer RNA biogenesis [BR:daf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Desaf_2764
 Prokaryotic type
   Other AARSs
    Desaf_2764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: EGJ51079
UniProt: F3Z101
Position
3051345..3053327
Genome map
AA seq 660 aa AA seqDB search
MDRFYITTPIYYVNGSPHLGHAYTTLVADSLARFHRAMGQETFFLTGTDEHGDKIVQAAD
KAGTTPQALVDANSAAFRDLWKRFGITNTGFVRTTEERHKRCVQAILQKVFDAGDIYHGE
YSGHYCFGCERFLTDKELVDGKCPDHQIAPELISEKNYFFRMSKYQGWLAEHIKANPGFI
RPQRYEAEVLSMLEGGVLEDLCISRPKSRLTWGIELPFDTDYVCYVWFDALLNYVSALGW
PEGEDYRAFWPMVEHLVAKDILKPHAVFWPTMLKSAGLTPYRHLNVHGYWLVRDTKMSKS
LGNVVDPLTMADKYGLSAFRYFLLREMQFGSDASFSEEALVGRLNADLANDLGNLFSRTL
TMTSKYFQGQAPDGQVETRDNSEILELARTAMENYQAQFAECVFSRALESLWELVRGLNK
YVDSRAPWTLAKEGRTEELATVMATLLMLLRKIALHLVPVMPDAADEMLAQLGQANAGRG
TLKDELCSWTRIEPGTEIAAKSNIFPRVDLAAEMATTPAKSEAASKPKAKPQVKGEAKKE
QAAKAVPASEELAEVEFQDFQKLDLRVGMVLDAMPHPDADRLLKLTVDIGEPAPRQIVAG
LAEFFTPEQIKGRLVTVLANLKPRKLRGLESQGMVLAVRTDSGMELLTPSGEVKTGSKVS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
ttggaccgtttttacatcaccacgccaatctactacgtgaacggcagtcctcacctgggt
catgcctacacaacgctggtcgctgattccttggccaggtttcatcgggccatgggtcag
gaaactttttttcttaccggcacggacgaacatggcgacaagatcgtgcaggctgcggac
aaggctgggaccactccacaagctctggtggacgctaacagcgccgcgttccgcgacctg
tggaagcgcttcggcatcaccaacaccggcttcgtgcgcaccacggaagagcggcacaag
cgttgcgtgcaggccatcttgcagaaggttttcgatgccggcgacatctaccatggtgag
tacagcggccactactgcttcggctgcgagcgcttcctgaccgacaaggagttggtggac
ggcaagtgcccggatcaccagatcgctcccgaacttatcagcgagaagaattacttcttc
cgtatgtctaagtatcaaggctggctggctgagcacatcaaggccaatcccggcttcatc
cggccgcaacgctacgaggccgaagtgctcagcatgcttgagggcggagtcttggaggac
ctgtgcatctcgcgtcctaaatcgaggctgacctggggcatcgagctgccttttgatacg
gattatgtgtgttacgtctggttcgacgcgctgctcaactatgtctcggccctgggctgg
cccgaaggtgaggattatcgcgccttctggcccatggtcgaacacctggtggccaaggat
atcctcaagccgcacgccgtgttctggcccacgatgctaaagtccgccggactcacgccc
tataggcatctcaatgtgcatgggtattggctcgtgcgcgataccaagatgtccaagtcc
ctgggcaacgtggtcgaccccctgaccatggcggacaaatacggcctgtccgccttccgt
tatttcctgttgcgcgagatgcagttcggcagtgatgcgagcttctccgaggaggccctg
gtgggccggctcaacgccgacttggccaatgacctgggcaatctgttcagccgcactttg
accatgaccagcaagtacttccaaggccaagccccggatggccaggtggaaacgcgggat
aactccgaaatcctggagctggcccgcacggccatggagaattaccaggctcagttcgcg
gaatgcgttttctcgagagccttggaatccttatgggagcttgtgcgcggcctgaacaag
tacgtggactcccgcgcgccatggactctggccaaggaggggcggaccgaagaactggcc
acagtcatggccacactgctcatgcttctacgtaaaatagccttgcatcttgtgccggtc
atgcccgatgctgccgatgagatgctcgctcagcttggacaggccaacgcagggcgggga
actctcaaggacgagctgtgctcctggaccaggattgagccgggcacggagattgccgcc
aaatccaatatcttccctcgtgtggaccttgcagccgagatggctaccactccggccaag
tccgaggctgcgtccaagcccaaagccaagccccaagtcaagggtgaagccaagaaggag
caggccgccaaggccgttccggcttccgaggagttggcagaggtcgagttccaggatttc
cagaaactcgacctgcgcgtcggcatggtcctggatgccatgccgcatcctgatgccgac
cgtctgctcaagctcacggtggatattggcgagcctgctccgcgccagattgtcgccggc
ctggccgagttcttcactccggagcagatcaaggggcgcctggtgaccgtacttgccaac
ctcaagccgcgcaagctccgcggcctggaatcccagggcatggtgctggcggtgcgtacg
gatagcggtatggagctgctgacgccctccggcgaggtcaagacaggcagcaaggtttcc
tga

DBGET integrated database retrieval system