KEGG   Desulfovibrio africanus: Desaf_2859Help
Entry
Desaf_2859        CDS       T01662                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
daf  Desulfovibrio africanus
Pathway
daf00970  Aminoacyl-tRNA biosynthesis
daf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desaf_2859
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:daf03029]
    Desaf_2859
Enzymes [BR:daf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Desaf_2859
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Desaf_2859
Mitochondrial biogenesis [BR:daf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Desaf_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: EGJ51172
UniProt: F3Z1N7
Position
3159323..3160756
Genome map
AA seq 477 aa AA seqDB search
MSRYEAVIGLEVHAQLKTRTKIFCGCSTQFGEEPNQNVCPVCSGMPGVLPVLNGKAVEYA
AKMGLAIGCTVNLRSVFARKNYFYPDLPKAYQISQFEQPICEHGKLDIEVDGQRKAIGIT
RIHMEEDAGKSIHNAAENQSYVDLNRCGVPLIEIVSEPDMRSAEEAVAYLKGLRSILLYL
GICDGNMEEGSFRCDANVSIRPRGQKELGTRAELKNMNSFRFVQKAIEYEIGRQEDLLDD
GEKVIQETRLFDSAKGVTVSMRSKEEAHDYRYFPDPDLIPIQIDEARLEKWRAELPEMPR
ARRERFVSEYGLPVYDAEVLTAEKEFADYFEAAVRAYHQPKKISNWMMTELLRELNLAKL
TPGQCVFRPEAMAKLVKLVEEGAISSTTGKTIFPDLFAIGTRDPEDYCKEKGLVQISDSS
ALEAAVDEVLAANPAEAERFRGGDKKLMGFLMGQIMRKTKGQANPQLVTELINKKLA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgctacgaagccgtgatcgggcttgaggtccatgcccagctcaagaccaggact
aaaattttctgtggatgctcaacgcagtttggcgaggagcctaaccagaacgtctgtccg
gtgtgctccggcatgcccggcgtgctgccggtgctcaacggaaaggccgtggagtacgcg
gccaagatgggcctggctattgggtgtacggtgaacctgcgttcggttttcgcgcgcaag
aactacttctatcccgacctgcccaaggcttaccagatttcccagttcgagcagcctatc
tgcgagcatggaaagctggacatcgaggtggacggccagcgcaaggccataggcatcacg
cgcatccacatggaagaggacgccggcaagtccatccataacgccgccgaaaaccagagc
tacgtggacctcaaccgttgcggcgtgccactcatcgagattgtcagcgagcctgacatg
cgcagtgccgaagaagccgtggcgtatctcaagggcctgcgctccatcctgctctatctg
ggtatctgcgacggcaacatggaagagggctccttccgctgcgacgccaacgtgtccatc
cggcctaggggccagaaggagcttggcacgcgcgccgaactcaagaacatgaactccttt
cgcttcgtgcagaaggcaattgagtatgaaatcggccgtcaggaagacctgctcgacgat
ggcgagaaggttattcaggaaacgcgcctgttcgattcggccaaaggtgtcaccgtgtcc
atgcgttccaaggaagaggcccatgactaccgctatttccctgatccggacctcatccct
atccagattgatgaggcgcggttggagaagtggcgtgcggaactgcctgagatgccaagg
gctaggcgggagcgcttcgtgagcgagtacgggctgccagtgtacgacgccgaggtgctc
acggccgagaaggagttcgccgactacttcgaggccgctgtgcgtgcctaccaccagccc
aaaaagatttccaactggatgatgaccgagcttctgcgcgagctgaacttggccaaactc
acgccgggtcagtgcgttttccgccccgaggccatggccaagctcgtcaagctggtggag
gagggcgccatcagctcgaccaccggcaagaccatctttccggatctcttcgccatcggc
acgcgcgatcccgaggactactgcaaggaaaaggggttggtgcagatctccgacagctcg
gctttggaagccgcagtggatgaggtcctcgccgccaatccggccgaggccgagcgcttc
cgaggcggagataagaagctcatgggcttcctcatgggccagatcatgcgcaagaccaag
ggccaagccaacccacaactcgtcaccgagctgatcaacaaaaagctggcttga

DBGET integrated database retrieval system