KEGG   Desulfosporosinus acidiphilus: Desaci_1876
Entry
Desaci_1876       CDS       T02148                                 

Definition
(GenBank) D-ornithine 4,5-aminomutase S subunit
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00472  D-Arginine and D-ornithine metabolism
dai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Desaci_1876
Enzymes [BR:dai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Desaci_1876
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A YAcAr
Other DBs
NCBI-ProteinID: AFM40853
UniProt: I4D4X9
Position
1938135..1938506
AA seq 123 aa
MQRKDDYEVRRAHLAELSEKELEERFWLLTNQIVDPLLELARTHTSPSIERSVLLRMGLD
SLTAKGVVEKALLNGVLEHGAGHCVWRYAEREGLELLQAAEKLARGEGWETIKDFFGEVK
HNA
NT seq 372 nt   +upstreamnt  +downstreamnt
atgcagcgtaaggacgattacgaagtgcggcgggcacatctggcggaacttagtgagaaa
gaactggaagaacgtttttggctattaactaatcagatcgtagaccctctgctcgaatta
gcacggactcatacgtcaccctccattgagcgatctgtgctcttacggatgggtttggat
agtcttacagcaaaaggggtcgtggaaaaagcgttattgaatggagttctggaacacgga
gccgggcattgtgtctggcgctatgcggaaagagaaggtttggaacttcttcaagcagcg
gaaaagttagcacggggagagggttgggagacaatcaaagatttcttcggagaggtgaag
cataatgcctga

DBGET integrated database retrieval system