KEGG   Desulfosporosinus acidiphilus: Desaci_1877
Entry
Desaci_1877       CDS       T02148                                 

Definition
(GenBank) putative cobalamin binding protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00472  D-Arginine and D-ornithine metabolism
dai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Desaci_1877
Enzymes [BR:dai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Desaci_1877
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AFM40854
UniProt: I4D4Y0
Position
1938499..1940709
AA seq 736 aa
MPDCSLDQHKKLNIEQILGNLESYRPRRKGWIWRKSVPQQKLGPFTYSQTSQGLKASQPL
PAAGFFGGIDPQPECTITSEIASGRFEDDLRRMRMAAYHGADHIMVIRTAGQSHYDGLLE
GTPEGIGGVPISRKQLRATRKALDLIEDEVGREINLHSYVSGVAGPEVAVLLAEEGVNGA
HQDPQYNVLYRNINAVRSFVDAAEAKKVMNWAEIAQIDGAHNANATAREAWKVMPELLVQ
HAINCAYSIKVGMPKDRICLSTVPPTAPPAPALRLDLPYAVALRELFAGFRMRAQMNTKY
MESDTREVTVTHTLNVLLSRLTSADIQSTITPDEGRNVPWHYNTVNGLNTAKQALVGLDG
LQEMVGIKREGILGDRVRELKERAVLFLEEILETGGYFEAVQQGFFVDSGFYPERNGDGI
VRDIKGGVGTEVLPRARDYFAPVCGHFGDNHRPEGVETICDKIGGCTLCVPEKIQWIDEL
DEEDNVNKRLEKSRPYRQETLTPEVQWAGDGVISMTLFLPTDIRTAHFAALEIAKQMGWK
ETEVIHKQVMHPAEGTVLEVKGKIGVTINPLTLKIPEAEERLSAELIRQKVQERPMLGVA
ATVGDDEHSVGLREILDIKHGGLEGFGMKFHYLGTSVPIAKVVDAALETGAKVILISTII
THGDMHRLNMQKLHDLCVERGVRDRLILVGGGTQVTNELAREWGMDAGFGRGTKGIDVAS
FLVKYREEHFPVKVRD
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgcctgattgttcactggatcagcataagaagcttaatattgaacaaattctggggaat
ctggaaagttatcgaccaagacgaaaggggtggatctggcgcaagtcggttcctcagcag
aagttaggaccgtttacgtactctcagacctctcaggggctaaaagccagtcagcctctt
cctgcggcgggtttctttggcggaattgatcctcaaccggaatgtaccattacgtcagag
attgcttccgggcgttttgaggacgacttaaggcggatgaggatggctgcatatcatggt
gcagatcacattatggtgattcgaaccgctggacaaagccattatgacggtttgcttgaa
gggacaccggaaggaattgggggagtcccgattagccgcaaacaactgcgggcaacccgc
aaagcattagatttgatcgaagatgaagtgggtcgggagattaatttgcattcttatgta
agtggtgtcgcagggccggaggttgccgttcttttagctgaggaaggggttaatggtgca
caccaagaccctcaatataatgtcctctatcggaatattaatgctgttcgctcgtttgtt
gatgccgccgaagctaaaaaggtcatgaactgggctgaaattgcgcaaatcgacggggca
cataatgcaaacgctacagcccgtgaagcttggaaggtgatgccggaactactggttcag
cacgctataaactgtgcctattctatcaaagtggggatgcctaaagatcgtatttgcctt
tcaaccgttcccccaacagcaccacctgcaccggcgctgcgtttggatttgccctacgct
gtggctttacgggaattgtttgccggctttcggatgcgggcgcaaatgaataccaaatat
atggaatctgatacacgggaagtgactgtcactcataccctgaatgttctgctttcccgc
ctcacttccgcggatattcaaagtaccatcactccggatgaagggcgtaatgttccctgg
cactataacacggtgaatggcctaaacacggccaagcaggcattggtggggttagacggc
ttgcaggaaatggtcgggattaaacgggaggggatcttaggagaccgggtgcgtgaactg
aaggaacgagccgttttgtttctcgaagaaatcctggagacaggcggttatttcgaagcg
gttcaacaagggttcttcgtggattcggggttttatccggaacggaatggtgacggaatc
gtcagagatattaaagggggagtgggaacagaggttttacctcgagctcgtgattatttt
gctccggtttgcggacactttggcgataatcacagaccggaaggggtagagactatatgt
gacaagatcggcggctgcactctttgtgtgccggaaaaaattcaatggattgatgaactt
gatgaagaggacaatgtcaataagcgtctggagaaaagccgtccttaccgtcaggaaacg
ttaacccctgaagtccaatgggcaggggatggcgttatcagtatgaccttgtttttgccg
acggatattcggacagctcattttgcggccttagagatcgctaaacaaatggggtggaag
gaaactgaggttattcataaacaagtcatgcaccctgcggagggaacggttttagaagtc
aagggtaaaataggagttacgattaatcccttgacacttaaaataccggaagcagaggag
cggctcagcgcagagcttattcgccagaaagttcaggagaggccaatgctgggggtggcc
gccactgtcggggacgatgaacattcggtggggttgagggaaattctggatatcaaacac
ggcggattagaagggtttggaatgaagtttcattacctaggaacctccgttccaatcgcc
aaagtagtggatgctgccctagagacaggcgctaaagttattttgattagcacgattatt
actcatggagatatgcatcgtcttaatatgcaaaaattacatgatttgtgtgttgaacgt
ggagttcgcgaccgcttgattcttgtaggaggagggacgcaagttaccaatgaattagcc
agggaatggggaatggatgccgggtttggaaggggaaccaaagggattgatgtggccagc
tttctggttaagtatcgggaggagcatttcccggtcaaagtgagggattag

DBGET integrated database retrieval system