KEGG   Desulfosporosinus acidiphilus: Desaci_2041
Entry
Desaci_2041       CDS       T02148                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00230  Purine metabolism
dai01100  Metabolic pathways
dai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desaci_2041
Enzymes [BR:dai01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Desaci_2041
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AFM41015
UniProt: I4D5E1
Position
2103604..2105967
AA seq 787 aa
MAYNVVGKSVNRVDAVAKVTGKAKYTDDFSERNMLVGKILHSPYAHAVIKSIDVSEAKAL
PGVEAVLTYKDLPRIKFSTALPGVANDVLDDEQEVDLPLFATAGHPYSLDPGHRDKEDRY
ILAKKARYVGDAIAAVVAEDAIIASKALKLIRVEYEVLEALTSPEAAMREGAPLIHEGSE
GNILSTGGGFERGDMEAALQESDYVIEGEYETSIVQHCHLELQTSHAYVDADGRINIVTS
TQIPQIVRRIVAQSLGLPWGRVRVIKPYIGGGFGNKQDVCYEPLNAAMTLAVGGRPVKLE
LSREEGMVDTRTRHAFKFKIKTGVNKDGTMNAIEISAISNTGAYASHGSSIAGSGGSKFR
YLYPVKAMKYSPVTVYTNLPVAGAMRGYGTPQIFYAFESHIEDIAKQLKLDPIEVRRKNL
VDVGYIEPLSKNKVLSCGIRECIDKGKELIRWDEKKEHYKNQNGDIRRGVGMACFSYASG
TYPVALELAAARIVLNQDGSVQLQLGATEIGQGSDTVFAQMTAEILGLPLSMVHVISQQD
TDISPFDTGSYASRQTYVSGMAVEKAALEVKGKILAFGQKMTDIPAHILDLKDQMIVYKH
SGEPVIPLWEVAMQSFYDRVNAQPITSDVSNNARINAMPFGVTFAEVEVDIKTGKIKILE
IYNVHDSGKIINPQLAAGQVHGGVSMGIGYALSEQLLFDEATGKPLNNNLLDYKLPTIMD
TPDIGAAFVEIEDPTGPFGVKALGEPPVISPAPAIRNAVLDATGVAFNRIPMNPQRVFEH
LKKAGLL
NT seq 2364 nt   +upstreamnt  +downstreamnt
ttggcttacaatgttgttggtaaaagcgtcaatcgagttgatgctgttgcaaaagtaacc
ggcaaggccaaatatacagatgatttttctgaacggaatatgttggttggaaaaatccta
catagcccttatgcgcatgccgttattaaatccattgacgtcagtgaagcgaaagctttg
ccgggagttgaggctgttctaacctataaagatctgccgcggattaaattttccacggcc
ttacccggggtagccaatgatgtgctggatgacgaacaagaggtggatttacccttgttt
gccacagcaggtcatccttattctttagacccgggtcatcgggataaagaggaccgctat
attctggctaagaaagcccgctatgtaggagatgccattgcggcagtcgttgccgaggat
gcaattatcgcttcgaaagcattgaaattgattcgcgttgaatatgaagtactggaggct
ttgacctcacctgaagcagccatgcgtgaaggagctcctttaatccacgagggaagtgaa
ggaaatattctctctaccggcggcggttttgaacggggggacatggaggcagctctgcag
gaatcggattatgtgatcgaaggagagtatgagacgagtattgttcaacactgccatctt
gaacttcagacgtctcatgcctatgtagatgccgatgggcggattaatatagtgacttcc
actcagattccccagattgtacggcgtattgtggctcaatccttaggtttgccttggggg
agagttcgggttatcaagccttatatcggcggcgggttcggcaataagcaagatgtttgc
tacgaacccttaaatgcggctatgactctcgccgttggcggccggccggttaaactggaa
ctttcccgggaggaaggaatggttgatacacggacacgtcacgcctttaaattcaagatc
aaaaccggtgtcaacaaagatggtacgatgaatgccattgagatttcggcgatatcaaat
accggagcctatgcctctcatggaagttctatcgcagggagcggaggcagcaagtttcgt
tatctctacccggtgaaggcgatgaaatactcgcctgttacggtctatacaaacttgccc
gttgccggtgctatgcgcggctatggaactccccagatcttttatgcctttgaatctcat
attgaggatatcgcaaagcaattaaagcttgatcctatcgaagtacgcaggaaaaactta
gtagatgtgggttatattgaaccccttagtaaaaataaagttttgagctgcggaattcgc
gaatgtattgacaaaggtaaagaacttatccgttgggatgagaagaaggaacactataaa
aaccaaaacggagatattcgacgcggtgtggggatggcttgcttcagctatgcttcgggg
acgtatcctgtcgctttggagttagcggccgctcgaatcgttctgaatcaagacgggtca
gtccagcttcagcttggagctacggaaataggccaaggaagtgacacggttttcgcacag
atgaccgcggaaattctaggactcccgctgtcgatggttcatgtgatttctcaacaggat
acagatatttcgccttttgatacaggttcctatgcctcgcgtcaaacctatgtcagcggg
atggctgttgaaaaggcagctttggaggttaagggtaaaatcttagcattcggccagaaa
atgactgatatacctgctcatattctggatcttaaagatcagatgattgtctataaacat
tcgggagaaccagttataccgctctgggaggttgccatgcagtccttctatgatcgagta
aacgcccagccgatcaccagcgatgtttctaataatgcccgtattaatgccatgcccttt
ggtgtaacgtttgctgaagtagaagtcgatattaagacaggcaaaattaagatattggaa
atctacaatgttcatgattcggggaaaattatcaatcctcaactggctgccggacaggtt
catggcggtgtgagcatggggataggatatgctttgtcggaacaactgctctttgatgaa
gccacgggaaaacccttaaataataatttgttggattataaacttcctaccattatggat
acaccggacattggcgctgcctttgtggaaattgaagatcccaccggaccctttggggta
aaggcattaggagaacctccggttatttctcctgccccggcgattcgcaatgctgtttta
gatgcgacaggtgttgcctttaatcgaataccgatgaatccccaacgagtctttgaacat
ttgaaaaaagctggattactgtaa

DBGET integrated database retrieval system