KEGG   Desulfosporosinus acidiphilus: Desaci_2043
Entry
Desaci_2043       CDS       T02148                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS-like protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00230  Purine metabolism
dai01100  Metabolic pathways
dai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desaci_2043
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AFM41017
UniProt: I4D5E3
Position
2106855..2107382
AA seq 175 aa
MFKKISFTVNGKSYSLDVDVRMSLLELLRNQLGYTGAKQGCGVGECGACSVLIDGTPYDS
CIYLAVWADGKAITTIEGVAAKNGELSKVQKAFIEEGAVQCGFCTPGLVLTTTALTESGK
DYTRDELKRELSGHLCRCTGYQNILKAAEKSLEGHICTCVDSPHYKQQQEKAKER
NT seq 528 nt   +upstreamnt  +downstreamnt
ttgtttaaaaagatttcatttacggtcaatggaaaatcatatagcctggacgtcgatgtc
cgtatgtctttgctggaacttttgagaaatcagttagggtataccggcgccaaacaaggg
tgcggcgtcggtgagtgcggagcctgcagtgtgttgattgacggaaccccttatgattct
tgtatttatttagcggtttgggcggacggcaaagctattacgactattgaaggagtagcg
gctaagaacggggagctctctaaagtccaaaaagcatttattgaggaaggcgcagttcaa
tgcgggttctgcactcccgggcttgttttgacgaccacagccttgacggaaagcggtaaa
gactacacccgcgatgaactcaaacgggaactttcggggcatttatgccgttgcaccggg
tatcagaatatccttaaagctgctgaaaagtctttggaaggacacatttgtacttgtgtt
gacagtcctcattacaagcaacaacaagaaaaagctaaggagagataa

DBGET integrated database retrieval system