KEGG   Desulfosporosinus acidiphilus: Desaci_2717Help
Entry
Desaci_2717       CDS       T02148                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00071  Fatty acid degradation
dai00280  Valine, leucine and isoleucine degradation
dai00310  Lysine degradation
dai00362  Benzoate degradation
dai00380  Tryptophan metabolism
dai00620  Pyruvate metabolism
dai00630  Glyoxylate and dicarboxylate metabolism
dai00640  Propanoate metabolism
dai00650  Butanoate metabolism
dai00900  Terpenoid backbone biosynthesis
dai01100  Metabolic pathways
dai01110  Biosynthesis of secondary metabolites
dai01120  Microbial metabolism in diverse environments
dai01130  Biosynthesis of antibiotics
dai01200  Carbon metabolism
dai01212  Fatty acid metabolism
dai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desaci_2717
   00630 Glyoxylate and dicarboxylate metabolism
    Desaci_2717
   00640 Propanoate metabolism
    Desaci_2717
   00650 Butanoate metabolism
    Desaci_2717
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desaci_2717
   00072 Synthesis and degradation of ketone bodies
    Desaci_2717
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desaci_2717
   00310 Lysine degradation
    Desaci_2717
   00380 Tryptophan metabolism
    Desaci_2717
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desaci_2717
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desaci_2717
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desaci_2717
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dai04147]
    Desaci_2717
Enzymes [BR:dai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desaci_2717
Exosome [BR:dai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desaci_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AFM41649
UniProt: I4D775
Position
complement(2845699..2846877)
Genome map
AA seq 392 aa AA seqDB search
MQLRDAVIVAPVRTPVGKCGGVLAEVPAYKLGAAVIKETIARAGIDPLEIDDVIMGNLFS
FDVANMARMCVLEAGLPLQVPGMTVDRQCSSALNAIMLAAALVMSGLGDVYIAGGAESDS
RRPYVMERADKAYKVQTAPKFFGIQASPPQIGNPPMGITAENVADLYGITRSEMDEFALQ
SHKKALVAIERGAFDEQIVPITIPQRKGSPLIVNRDECPRPDISLEALSKLKPAFKEGGT
VTAGNSSPMNDGASACVVMSREKAEEMGLDWMLKFKAYAIAALDPNYMGLGPIHSTRKLL
KQTGTVIKDFDVLELNEAFAAQSIACIRDLGMDMEKVNVNGGAIALGHPLAATGGILTAK
LAYLMRERQLKNGLISFCCGGGQGVTAWFEAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgcaattaagagatgcggttatcgttgcgccggttagaacgcctgtcggtaaatgcggc
ggagttcttgcagaagttccggcctataagttgggtgcggcagttattaaagagactata
gcaagagcggggatagatcctctggaaattgacgatgtgattatggggaatttgttttct
ttcgatgtggccaatatggctcgcatgtgtgtgcttgaagcaggcctgcctcttcaagta
ccgggaatgaccgttgaccggcaatgttcctcagccctaaatgctattatgttagctgct
gctctagtcatgagtggtcttggcgatgtttatatagcaggaggtgctgaaagtgattcg
cgaagaccctatgtcatggaaagggcggataaggcttataaagtgcaaacagctccaaag
ttttttggcattcaagcgtctcctccacaaatcggcaatccacccatgggaataactgcc
gaaaatgttgctgatctttatggaattacgcgcagtgaaatggatgaatttgcccttcaa
agccataaaaaagctttggttgcaatcgaacgaggagcgtttgatgaacagattgtaccg
atcacaattccgcagcgcaaaggttctccgcttattgttaaccgagatgagtgccctcga
ccggatattagtttggaagctttatcgaaattaaagccggcatttaaggagggtggtact
gttaccgcgggcaacagttctccaatgaacgacggagcttctgcttgtgttgtaatgtcg
agagaaaaggctgaagagatgggactcgattggatgttaaagttcaaagcctatgcgatt
gcagcattggatcccaattacatgggtttaggtcctattcattcaacacgcaaactatta
aaacaaacgggtacggtgatcaaggattttgatgttttagaattaaatgaagcctttgct
gcccaatctatagcgtgtattcgagatttagggatggatatggaaaaggtcaatgtcaat
ggcggtgcgattgctttaggacatccgcttgcggctacaggcggaattctaacagccaaa
cttgcttatcttatgcgtgagcggcagcttaaaaatggtctgatttctttctgctgtggc
ggcggacagggtgtaacagcatggtttgaagctcgataa

DBGET integrated database retrieval system