KEGG   Desulfosporosinus acidiphilus: Desaci_3204Help
Entry
Desaci_3204       CDS       T02148                                 

Definition
(GenBank) putative metal-dependent phosphoesterase, PHP family
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
dai  Desulfosporosinus acidiphilus
Brite
KEGG Orthology (KO) [BR:dai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Desaci_3204
Enzymes [BR:dai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Desaci_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AFM42105
UniProt: I4D8I1
Position
complement(3342476..3343321)
Genome map
AA seq 281 aa AA seqDB search
MESVIFEVDLHCHTTASDGELTPSELVHCAAGLGLKGVGITDHDTIQGWKEAEEAAKVYQ
IKLVKGIELNTDWNGKEVHILGYELDDSSDYLRHRLQNLRDARKQRMLEIIERFRRLGIT
IEVQEVQKYAKGESMGRPHIAQALMEMGYVTSIKEAFERYIGRGAPAYVPRYKLTPEEAI
ELIRESHGVAVLAHPGIYRLEEGIRPWIDAGLQGIEVAHSEHNQEDEQRYRALAGDYHLI
MTGGSDFHGEKHKPGVKLGHWGVSEDVIQQILTLAKGNTLK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttggagtcagtaatattcgaagttgatttacattgccacacaactgcatcggatggagag
cttacgccatcggagcttgtacattgcgctgccggcttaggcttgaaaggggttggcatt
accgaccacgatacgattcaaggatggaaagaagctgaagaagctgcaaaagtctatcaa
atcaagctagttaagggtattgaattaaataccgattggaatggcaaagaggtacatatt
ctaggatatgagctcgatgattcctccgattacttaaggcataggttacaaaatttaaga
gatgctcgtaagcagagaatgctcgaaatcattgagcgttttcggcgcttggggatcacc
attgaagtccaagaagttcaaaagtatgccaaaggtgaatcaatgggccgtccgcatatt
gctcaggcacttatggagatgggttatgtcaccagcattaaagaagcttttgagcgttac
attgggaggggtgctcccgcttatgttccgcgttataaactgactccggaagaggcaatt
gaactaattagggaatcccatggagttgctgttcttgcgcatcctggcatatatcgtctt
gaagaaggaatccggccttggattgatgccggtttacaaggcatcgaagtagcccattcc
gaacacaatcaagaagatgaacaacgatatcgtgctttagcgggggactatcatttaatc
atgacaggtgggtctgattttcacggtgagaaacacaaaccgggtgtaaaactcggtcac
tggggtgttagtgaggatgtaattcaacaaatattgaccttagcaaaaggtaatactctc
aaatag

DBGET integrated database retrieval system