KEGG   Desulfosporosinus acidiphilus: Desaci_4373Help
Entry
Desaci_4373       CDS       T02148                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00630  Glyoxylate and dicarboxylate metabolism
dai00660  C5-Branched dibasic acid metabolism
dai01100  Metabolic pathways
dai01120  Microbial metabolism in diverse environments
dai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Desaci_4373
   00660 C5-Branched dibasic acid metabolism
    Desaci_4373
Enzymes [BR:dai01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     Desaci_4373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C Enolase_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AFM43217
UniProt: I4DBP3
Position
complement(4526834..4528084)
Genome map
AA seq 416 aa AA seqDB search
MKIIDIIASPGLTGFYFDDQQAIKAGAGHDGFSYTGEPITPGFKAVRQRGESISVMLILE
DGQVAAGDCAAVQYSGAGGRDPLFLAEDFIPIILEEIAPKLLGQELNSFRQLVGLVEHSK
RPNGERYHTAIRYGVSQAILDAVAKAKKKTMTEVILEEYDLPLTLEPVPIFTQTGDDRYD
NADKAIIKRAGVLPHALINNVETKLGANGELLLDYVIWLRNRILTIGGEDYRPVLHIDVY
GTIGIAFKDDTERMVEYFAELEKAAAPLHLRIEGPMDAGSIDGQIDQLKALRVALKKRGV
NVEIVADEWCNTYEDIVRFVDAQAADMVQIKTPDLGGIQNTIEAVIYAKKYGVGAYVGGS
CNETDSGGRTAVHVSLAARPDQMLAKPGMGVDEGYMIVHNEMNRTLALLKRKASNR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgatataattgcttcaccaggtcttaccgggttttattttgatgaccaa
caggcgatcaaggcgggagcgggacacgatggtttttcctataccggagagccgatcacg
ccaggttttaaagcggttagacagcgtggggagtccatttctgtcatgttaatcttggaa
gacgggcaagtagctgctggagattgtgcagcagtccaatattcaggggcaggtggccga
gatccgttgtttttagctgaggattttattcccatcattttggaggaaattgcgcctaag
cttttaggtcaggaactgaactctttccgccaattagtgggcttagtggaacattcaaaa
cggcccaatggggaacgttatcacacggcaatccgctatggagtcagccaagcaattctg
gatgccgttgctaaagcgaagaagaaaacgatgactgaggttattctggaagaatatgat
ctgccgctgacgcttgaacctgttcctatctttactcaaaccggggatgatcgttatgat
aatgccgataaggcaattattaagcgtgccggagtattgccccatgccttaatcaacaat
gttgagacaaagcttggagccaatggagagctgcttttagattatgtaatctggttgaga
aatcgcatccttacgatcggaggagaggattaccgtccggtgcttcatattgatgtttat
ggaacgatcggaatagcctttaaggatgatacagaacgaatggtcgaatattttgcagaa
ctggagaaagccgcagctcctctgcatttgagaatcgaaggtcctatggatgcaggaagt
attgacggacagatagatcagctgaaggctttgagggtggccttgaaaaaacgaggagtg
aatgtggaaattgtcgccgacgaatggtgcaatacctatgaagatattgtgaggtttgtg
gacgctcaagcggcagatatggtacaaattaaaacccccgatttaggaggaattcaaaac
accattgaagcagttatctatgctaaaaaatacggtgttggcgcttacgtcggcggatca
tgcaacgaaacagactccgggggacgtacagctgttcatgtttccttggcagcccgtcct
gaccaaatgctggcaaagccgggaatgggtgtggatgaaggatatatgatcgttcataat
gaaatgaacaggacactcgccttgttaaagagaaaggcttcaaatcggtaa

DBGET integrated database retrieval system