KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0002Help
Entry
DaAHT2_0002       CDS       T01244                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00860  Porphyrin and chlorophyll metabolism
dak01100  Metabolic pathways
dak01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DaAHT2_0002
Enzymes [BR:dak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     DaAHT2_0002
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     DaAHT2_0002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 FAD_binding_3 FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Thi4 MCRA GIDA
Motif
Other DBs
NCBI-ProteinID: ADH84719
UniProt: D6Z562
Position
complement(1851..3248)
Genome map
AA seq 465 aa AA seqDB search
MDQQHAVIIVGAGLSGLATAHFLAAAGTPALLLEADGRAGGAIRSFNDEGYRAEWGPHGF
LDNNPASRQLLQETGLEQEALKAPLGQNVRYVCHHGRLVALPQSPQALLTTPLLSLAGKL
RLALEPFKKTLADGASIGQWAEHRFGREVLPLVDAAVTGTFAGDYQRLSIDAVMPGVRRL
EKEHGSLLRGLWRERRQRRSKPPATTGAKSGPAGLPAMTSFPQGMEQLITRLSQQKEIVY
QCRVEKIRPLTEGGWEITTNSGPYQAKRLVLALPVNQALELLADFKPPVGSVPEARIVTV
ALGFSRDEATIPAGFGYLAPERENRFTLGALFSSHMFPERAPAGHVLLEALVGGRRHPER
LELDDAAMIANIYQDLRQLLPLKAPPAFARVLRGAGGIPQLEQDHPRLLAWREKLATRHP
SLQLTGFGWDGIGMNDMMKAAQKAAELITRGRQEEEQAAVRPVYF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacagcacgcagtgattatcgtcggggccggcctttccggcctggccacggcc
cactttctggctgccgccggcactcccgccctgctcctggaggccgacggacgagcaggc
ggggccatccgttccttcaatgacgaaggttaccgggcggaatggggcccgcacggtttt
ctcgacaataacccggccagccgacagttgctgcaggaaaccggcctggagcaggaggcg
ctcaaggcgccgctggggcagaatgttcgctatgtctgccatcacgggcggctggtggcc
ctgccccagagcccgcaagccctgctgaccacccctctgctctctttagccggtaagctg
cggctggcgctggaacccttcaaaaaaaccctggccgatggcgccagcatcggccaatgg
gctgaacaccgcttcggccgggaagtgctgccgctggtggacgcggcggttaccggcacc
tttgccggtgactaccagcgcttgagcatcgacgcagtgatgcccggcgttcggcggctg
gagaaagaacatggttcactgcttcgcggcctctggcgggaaaggcggcagcgccgcagc
aaaccgccggcgaccaccggcgccaagtccggccccgccggattgccggccatgaccagc
tttccccaaggcatggaacagctgattactcgcctgagccagcaaaaagagattgtttac
cagtgtagagtggaaaaaattcgcccgctcaccgagggcggctgggagattacgaccaat
agcggcccctaccaggcaaagcgcctggtgctggccctgccggtgaaccaggcgctggaa
ctgctggcggacttcaagccaccggtcggcagtgtgcccgaggcccgcatcgttaccgtg
gccctgggcttcagccgggatgaggcgacaattccggccggcttcggctacctggccccg
gagcgggaaaaccgcttcaccctgggggccctgttctcctcacacatgttcccggaacgg
gcccccgccggtcatgtactgctggaagccctggtgggcggccggcgccacccggaacga
ctggaactggacgatgccgcgatgatcgccaacatctatcaggatctgcgtcaactgctg
cccttaaaggccccgccggccttcgcccgggtgctgcggggagccggcggcattccgcaa
ctggagcaggatcatccccgcctgctggcctggcgggaaaagctggccaccagacacccc
agcctgcagttgaccggcttcggctgggacggcatcgggatgaacgacatgatgaaggcc
gcccaaaaagccgccgagctcatcacccggggccgccaggaagaggaacaggcagccgtg
cgcccggtctatttctga

DBGET integrated database retrieval system