KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0642Help
Entry
DaAHT2_0642       CDS       T01244                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00260  Glycine, serine and threonine metabolism
dak00750  Vitamin B6 metabolism
dak01100  Metabolic pathways
dak01110  Biosynthesis of secondary metabolites
dak01120  Microbial metabolism in diverse environments
dak01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DaAHT2_0642
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DaAHT2_0642
Enzymes [BR:dak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DaAHT2_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADH85348
UniProt: D6Z193
Position
756157..757548
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGGIAPIPFSEAVMMGLADDGGLLLPEKLPQATGEEIAVWRRLNYPDLAVAVLS
HFIDDIPAADLERLVKKSYAAFQHPEVTPVVKQGQCHILELFHGPTLAFKDVALQLLGNL
FEYLLAKSGGRMNIIGATSGDTGSAAIYGVRGKERINIFILHPHGRVSPIQEKQMTTVLD
ANVFNIAVKGTFDDGQAIVKKLFGDLNFKQQHQLGAINSINWARIVAQVVYYVYAALKLT
GEGKAAQVDFAVPTGNFGDIFAGFVARRLLPKQIGQLILATNENNLLTRFVKDGDYSVSG
VRPTSSPSMDIQVASNFERYLYYLNDQDAQRTRQEMEQFAATGSLQFDPARLQRIQQDFA
SQSADEAATKATIGDFYQSHDYLLDPHTAVGVYAGLACRRPEVPLVCLATAHPAKFGQAV
EAAIGRPPELPPPLAALAKLESRCQVLPAEEQVIKDFVAQHAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatttcaaccaggggtggcatcgcccccatccccttcagtgaagcggtaatg
atgggcctggctgacgacggcggcctgctgctgccggaaaagctgccccaggccaccggc
gaggagatcgccgtctggcgccgcttaaattacccggacctggcggtggcggtgctcagc
cacttcatcgacgatatccccgccgccgacctggagcggctggtaaagaaatcctacgcc
gctttccagcatcccgaagttaccccggtggtcaagcagggccagtgccacatcctggaa
cttttccacggcccgaccctggcctttaaagacgtggccctgcaactgctgggcaacctc
tttgaatatctgctggccaagtccggcggccggatgaacatcatcggggccacctcgggc
gataccggcagtgccgccatctacggggtgcggggcaaggagcggatcaacatctttatt
ctccatccccacgggcgggtcagccccatccaggaaaagcagatgaccacggtgctggat
gccaatgtgttcaacatcgccgttaaaggcacctttgatgatggccaggccatcgtcaaa
aaactcttcggcgacctgaacttcaagcaacagcaccagcttggggccatcaactccatc
aactgggcccggatcgtggcccaggtggtctactacgtttacgccgccctcaaactcacc
ggcgagggcaaggcagcgcaggtggattttgccgtgcccaccggtaatttcggcgatatc
ttcgccggctttgtcgcccggcggttgctgccaaagcaaatcggtcaactgattctggcc
accaacgaaaacaacctgctcacccgcttcgtaaaggacggcgactactcggtcagcggc
gtgcggcccacctccagcccctccatggatatccaggtggccagcaacttcgaacgctat
ctgtattatctcaacgaccaggacgcccagcgcacccggcaggagatggaacaattcgcc
gccaccggcagcctgcagtttgaccccgccaggctgcagcgcatccagcaggattttgcc
tcgcaaagcgccgacgaggccgccaccaaagccaccattggcgacttctaccagagccat
gattacctgctggacccccacaccgccgtgggggtttacgccggcttggcctgccgccgg
ccggaggtccccctggtctgcctggccaccgcccatcccgccaagttcggccaggcggtg
gaggcagccatcggccggccgccggagctgccgccgccgctggcggcccttgcaaaactg
gaaagccgatgccaggtgctgccggccgaggaacaggtaatcaaggacttcgtcgcccag
cacgctctgtga

DBGET integrated database retrieval system