KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0973Help
Entry
DaAHT2_0973       CDS       T01244                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00900  Terpenoid backbone biosynthesis
dak01100  Metabolic pathways
dak01110  Biosynthesis of secondary metabolites
dak01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DaAHT2_0973
Enzymes [BR:dak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DaAHT2_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ADH85676
UniProt: D6Z2A1
Position
1170202..1171401
Genome map
AA seq 399 aa AA seqDB search
MTKNISLLGSTGSIGCNVLDVVRQYPGRFRVVGMAAGSNIRLLREQIEAFHPMLVSVADD
TLAGELIQSLPPGWSERVLVGRAGNEEVAALPEADLVVSAIVGAAGLTPTMAGIEAGKDI
ALANKETLVMAGELVMNAVARRQVQILPIDSEHNAIAQSLSAGRHQDIHRLILTASGGPF
RDKPSRELWEVTPEQALNHPNWSMGRKISIDSATLMNKGLEVIEAHWLFGVPVEQIEVLI
HPQSIVHSMVEYIDGSVVSQMGIPDMRIPIVYALAYPERLRLDLPRLNLTKTGPLTFLPP
DYSRFPALELAYKACKRGGTRPAALNAANEVAVEAFLDGKIRFPEIALVVAETVSRVEHK
PVERIATVLAIDLAARMMAESIVESLMIKAEQKRNKVTP
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaacatctccctgctgggctccaccggctccatcggctgtaacgtactggac
gtggtccgccagtaccccggccgcttccgggtagtgggcatggcggcgggcagcaatatt
cgactgctgcgggaacagatcgaagcctttcaccccatgctggtgtcggtggccgacgat
accctggccggtgagctgatccagagcctgccgccgggctggagcgaacgggtactggtg
ggccgggccggcaacgaagaagtggccgccctgccggaagccgacctggtggtttcggcc
attgtcggggccgccgggctgacccccaccatggccggcattgaggctggcaaggacatt
gccctggccaacaaagaaaccctggtgatggccggtgaactggtgatgaacgccgtggcc
cgccggcaggtgcagatcttgcccatcgacagcgagcacaacgccatcgcccaatcatta
agcgccggccgccaccaggatatccaccggctgatcctcaccgcctccggcggcccattc
cgggacaaaccttcccgggagctgtgggaagtcaccccggaacaggccctgaaccacccc
aactggtccatgggccgcaagatctccattgattccgccaccctgatgaataaaggcctg
gaagtgatcgaggcccactggctgttcggagtcccggtggagcaaatcgaggtgctgatc
cacccccagagtatcgttcactccatggtggagtatatcgacggctcggtggtgtcccag
atggggatccccgacatgcggattcccatcgtatacgccctggcttacccggagcgcctg
cgcctggatctgccccggctgaacctgaccaaaaccggcccgcttactttcctgccgccg
gactacagccgttttcccgccctggaactggcctacaaggcctgcaagcggggcggcacc
aggccggcggccctgaatgccgccaatgaagtggcggtggaggcctttctggacggcaaa
atccgcttcccggaaattgccctggtggtggccgaaacggtcagccgggtggagcataaa
ccggtggaacgcatcgccaccgtcctggccattgacctggccgcccgcatgatggccgag
tccatcgtggagtcgttgatgatcaaggccgagcaaaaaagaaacaaggttaccccatga

DBGET integrated database retrieval system