KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1365Help
Entry
DaAHT2_1365       CDS       T01244                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00260  Glycine, serine and threonine metabolism
dak00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dak01100  Metabolic pathways
dak01110  Biosynthesis of secondary metabolites
dak01130  Biosynthesis of antibiotics
dak01230  Biosynthesis of amino acids
Module
dak_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DaAHT2_1365
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DaAHT2_1365
Enzymes [BR:dak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DaAHT2_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADH86060
UniProt: D6Z3D5
Position
1612753..1614021
Genome map
AA seq 422 aa AA seqDB search
MKPGYYGNWGGAFVPEILHETFRQLNAFFTEAQADPAFWRQYVDLMGSYSCRPTPLTLAE
NLTRRFGGASIYIKREDLNHTGAHKANNVMGQGLLVQRMGKRRVIAETGAGQHGVATATM
AAKFGFECTIYMGEEDVQRQRPNVFWMEKLGATVVPVTSGSRTLKDAINEAFRDWVANMD
STHYVMGTVCGPHPFPAMVAWFQKIIGEEAKEQILAAHGRLPARVYACVGGGSNAMGIFQ
GFLADEEVELVGVEAGGEGLTSGRHASRLAAIPTTADTDGIPDATPGVAQGYKTMFLQDD
DGQMKDTHSVAAGLDYIGVSPMLADLWERGRVRMTAATDTEVMEALQLAMASEGIIPALE
SAHAFVQAFKEAGELSPESAIIINQSGRGDKDIFTIAHAFKDPSWREFIRAKGEEYGKEP
VS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaggttattacggaaactggggcggggccttcgtgcctgagatcctgcacgaa
accttccgccaactcaacgccttctttaccgaggcccaggccgacccggccttttggcgg
cagtatgtggacctgatgggcagctactcctgccgccccacccccctcaccctggccgaa
aacctcacccgccgcttcggcggcgccagcatttacatcaagcgcgaggatctcaaccat
accggggcgcacaaggccaacaacgtcatgggccaggggctgctggtgcagcgcatgggc
aaacgccgggtgatcgccgaaaccggcgccggccagcacggggtggccaccgccaccatg
gccgccaagttcggttttgaatgcaccatctacatgggcgaggaagatgtgcagcgccag
cgccccaacgtcttctggatggagaaactgggcgccaccgtagtgccggtgacctcgggc
agccgcaccctgaaagacgccatcaacgaggccttccgcgactgggtggccaacatggat
tccacccactacgtgatgggcacggtttgcggcccccacccctttccggccatggtggcc
tggtttcaaaaaatcatcggcgaggaggccaaagagcagatcctggccgcccacggccgc
ctgccggcccgggtttacgcctgcgtgggcggcggctccaacgccatgggcatcttccag
ggctttctggccgacgaggaggtggaactggtgggggtggaggccggcggcgaagggttg
accagcggccggcacgcctcccggctggcggcaatacccaccaccgccgataccgacggc
atccccgatgctactcccggggtggcccagggctacaagaccatgtttttacaggacgac
gacggccagatgaaagacacccactcggtggccgccggcctggactatatcggggtttcg
cccatgctggccgatctctgggagcggggccgggtccggatgaccgccgccaccgacacc
gaggtcatggaggccctgcaactggccatggccagcgagggtatcatcccggccctggaa
tcagcccacgcctttgtccaagcctttaaagaggccggggagctgtcgccggaaagcgcc
attatcatcaaccagtcgggccggggcgacaaggatatcttcaccatcgcccacgccttc
aaagatccttcctggcgggagttcatccgcgccaaaggcgaggaatacggcaaggagccg
gtatcatga

DBGET integrated database retrieval system