KEGG   Desulfurivibrio alkaliphilus: DaAHT2_2198Help
Entry
DaAHT2_2198       CDS       T01244                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00010  Glycolysis / Gluconeogenesis
dak00620  Pyruvate metabolism
dak00640  Propanoate metabolism
dak00680  Methane metabolism
dak01100  Metabolic pathways
dak01110  Biosynthesis of secondary metabolites
dak01120  Microbial metabolism in diverse environments
dak01130  Biosynthesis of antibiotics
dak01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DaAHT2_2198
   00620 Pyruvate metabolism
    DaAHT2_2198
   00640 Propanoate metabolism
    DaAHT2_2198
  Energy metabolism
   00680 Methane metabolism
    DaAHT2_2198
Enzymes [BR:dak01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DaAHT2_2198
Lipid biosynthesis proteins [BR:dak01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DaAHT2_2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADH86863
UniProt: D6Z698
Position
complement(2561876..2563870)
Genome map
AA seq 664 aa AA seqDB search
MSGEDSKIESMMQEKRLFAPPPAPADTVSAKSMAEYEEWYRQSMDDPEGFWAQRAEELIQ
WDKKWDQVLEADMVKPEVKWFKGGKLNVSVNCLDRHLANGRRNKAALIWQGEPEEDVRVY
TYQMLHTEVCRMANVLKKMGVGKGDRVAVYLPMVPELAIILLACTRIGAIHSVVFAGFSA
ASLKSRMQDCEAKVLVTADAVLRAGKTIPLKPNADEALAECPSVQNCVVVKRGGNEINMQ
QGRDTWWHEAITADGITADCPPESMDAEDTMLILYTSGSTGKPKGVVHTTGGYLTYAAQT
CRWVFDLKDDDVYWCTADIGWITGHSYILYGPLALGATSVMFEGVPSWPKPDRFWQICDK
FKVNIFYTAPTVIRSLMREGTDWPNKHDLSSLRLLGSVGEPINPEAWMWYHEHIGKSRLP
VVDTWWQTETGGIMISAMPYATPLKPGSATKPLPGIDAAVLREDGSEAAANEGGHLVIRR
PWPGMLRGVFGDPERYKKTYFSRYEGIYDPEDGSRKDEDGYFWIMGRLDDVINVSGHRMG
TAEIESALVAHKDVAEAAVVGAPHEVKGQTIYAYVSLKSGVNPSDELRAALRTHVRKEIG
PIATPEFIQFADGLPKTRSGKIMRRILRKIAAGQTEEHDFGDTSTLADPSVVDTLVAGSK
EFIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagaagacagcaagattgaaagcatgatgcaggaaaaacggctctttgcaccg
ccgcctgcccccgccgatacggtttccgccaaaagcatggccgaatatgaagagtggtac
cgccagtccatggacgacccggaagggttctgggctcaacgggccgaagagctgatccag
tgggacaagaaatgggaccaggtcctggaagcggacatggtcaagccggaggtaaaatgg
ttcaagggcggtaagctcaacgtctcggtcaactgcctggaccggcatctggccaacggt
cgccgcaacaaggcggctttgatctggcagggcgagcctgaagaagacgtgcgggtttac
acctaccagatgctgcataccgaggtctgccggatggccaacgtgctgaagaaaatgggc
gtgggcaagggcgaccgggtggcggtttacctgcccatggtgcctgagttggccattatt
ctgctggcctgtacccgcatcggcgccatccacagtgtggtttttgccggcttttccgcc
gccagcctcaaaagccggatgcaggactgcgaggccaaggtgctggtcaccgccgatgcc
gtactgcgggccggcaagaccatccccttaaagcccaacgccgacgaggccctggccgaa
tgccccagtgtccagaactgcgtggtggtcaagcggggcggcaacgagatcaacatgcag
caagggcgtgatacctggtggcacgaagccatcaccgccgacggcatcaccgccgactgc
ccgcccgagagcatggacgccgaagacaccatgctgatcctctacacctcgggctccacc
ggcaaacccaaaggggtggtgcacaccaccggcggctacctgacttacgccgcccaaacc
tgccgctgggtgtttgacctcaaagatgacgatgtctactggtgtaccgccgatatcggc
tggattaccgggcacagctacatcctctacgggccgctggccctgggcgccacctcggtg
atgttcgaaggggtgccgagctggcccaagcccgatcgcttctggcagatctgcgacaag
ttcaaggtcaatattttctataccgcccccaccgtgatccgctcgctgatgcgggagggc
accgactggcccaacaagcatgacctttcttcgctgcgactgctgggctcggtgggcgag
cccatcaaccccgaagcctggatgtggtaccacgagcatatcggcaagagcaggctgccg
gtggtggacacctggtggcagaccgaaaccggcggtattatgatttcggccatgccctat
gccactccccttaagcccggctcggccaccaagcccctgcccggtatcgatgctgccgtg
ctgcgggaagacggcagcgaggcggcggccaacgaaggcggccacttggtcatccgccgg
ccctggcccggtatgctgcgcggagtgttcggcgacccggagcgttacaagaagacctac
ttttcgcgctatgaagggatctacgacccggaagacggctcccgcaaggacgaggacggc
tacttctggatcatgggccgcctggatgacgtgatcaacgtctccggccaccgcatgggt
accgccgagatcgaatcggccctggtggcccataaggacgtggctgaagcggcggtggta
ggtgccccccacgaggttaagggccagaccatttacgcctatgtttctctgaagagcggc
gttaaccccagcgacgagctgcgggccgccctgcgcacccatgtccgcaaagagatcgga
cccatcgccaccccggagttcatccagtttgccgacggcctgcctaaaaccagaagcggc
aaaatcatgcgccggattttgcgcaagatcgccgccggccaaaccgaagagcacgatttc
ggcgatacctccaccctggccgatccttcggtggtggataccctggtggccggcagcaag
gagtttataaaataa

DBGET integrated database retrieval system