KEGG   Desulfatibacillum aliphaticivorans: Dalk_2579
Entry
Dalk_2579         CDS       T00813                                 

Name
(GenBank) Pyruvate formate lyase
Organism
dal  Desulfatibacillum aliphaticivorans
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACL04272
UniProt: B8FFL2
Position
complement(3355045..3357456)
AA seq 803 aa
MPLSTNEKQARPASPGLFLVKKKDRVTRLKEAVQAATPGICTERALLWTEYFKDKANQSK
HVYVQMAEALAHSQKNRSIAVHPGELIVGNYTSRRVGGLLFPELHGLVVMQDLFKFPNRE
TNPLEVSRLDQARLLSIAPFWATRMLAVKTCDSWLDTFSLVLNQLMGNYYIINEAAGISH
IAPDYETLCRLGTDGIAAKAAKLQKQSLMDADKWYFYESVRIAAEGLAAFGERYAQLAGE
MAERELDEDLAAELKGIAEVCSRVPRKGAKTFREALQSCFFAQIAINNESLDNSVCPGRM
DHYLYPYYEKDLKAGLLTREEAKELAGAFSVKMSEIVPVFSKYITRTHGGFFNGQIVNVG
GTHKNGKDSTNELTMIFLEVMDELRMRQPNYTARVHKNSPKEYLDKVYGILSKGANSPSI
YNDEVIVPVLKQNGVKIGDARNYTPVGCVEPVAQGVSFSSTDAALFNTAIILELALNQGR
RLGRVAQIGAKTKPVSQMTCIEDVQEAFEIQMFHGINRLLKDLQAIEIANAEYHPTPLSS
MLLDGCLENGACSTRGGARYNFSGIQCVGLVDAGDSLAAIKQAVFEDKKLSMEELVEHLK
NNLSDDRWRHYLLNMPKFGNDDPFADVWTAYALDVFKAALDGKTSTRGGKYTVGVYSVTL
HEYWGTVVSALPNGRRNGESLSNGMSPSNGQDRKGPTAVLNSMNRIDYSKTDNGINFNIK
FDANTVGSPAGCTAMKSIFSTYFKRGGMQAQINVLDPKVLIEARDNPEAYPHLLVRVSGY
SAYFNDLTPAMKEEMIRRTSMGL
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgccattgtctacgaatgaaaagcaagcccgccctgcctcgcccgggctgttcctggtt
aaaaagaaagaccgcgtgacccgcctgaaagaggccgtccaggctgcaacgccgggaatt
tgcacggagcgcgccttgttatggaccgaatacttcaaggacaaggccaatcagagcaag
cacgtttacgtgcaaatggccgaggctctggcccactcccagaaaaaccgctccatcgcc
gttcatccgggcgagttgattgtgggcaattacacctcccgcagggtgggggggctgttg
ttcccggagctgcacgggctggtggtcatgcaggacctgttcaagtttcccaatcgagaa
accaatcccttggaggtatcccgtctggaccaggcccgcctgctgtccattgcgccgttc
tgggcgacccggatgctggccgtgaagacctgcgactcctggctggacaccttttcgttg
gtcctgaatcagctcatggggaactattacatcatcaacgaggccgccgggatttcccac
atcgctccggattacgaaaccctctgccgcctgggaacggacggcatcgccgcaaaggcc
gccaagctccagaagcagagcctcatggacgcggacaagtggtatttttacgaaagcgtg
aggatagccgccgaggggctggccgcctttggagagcgttacgcccaattggccggggaa
atggcggaaagggaattggacgaagatcttgcggcggagttgaaaggcatcgccgaggtt
tgctcacgggttccccgtaaaggcgccaaaaccttccgcgaagctctgcaaagctgcttt
ttcgcccagatcgccatcaataacgaaagcctggacaactccgtctgccccggcaggatg
gatcattatttatatccctattatgaaaaggacctgaaagcaggcctcctgacccgcgag
gaggccaaagagcttgcgggcgccttttccgtaaaaatgtccgagatcgtgccggttttt
tccaaatacatcacaaggacccatgggggcttttttaacggccagatagtcaacgtgggg
ggaacccataaaaacggcaaggactccaccaacgaactgaccatgatttttttggaagtc
atggacgagttgcgcatgcgccagcccaattacacggcccgggtccacaaaaactccccc
aaagaatacctggacaaggtttacggcattctttccaaaggcgccaattccccctccatt
tacaatgatgaggtgattgttcccgtcttgaagcaaaacggcgtgaaaatcggcgacgcc
cgcaattacacccccgtgggatgcgtggagcctgtcgcccagggggtatctttctcctcc
acggacgcggccttgttcaatacggccatcatcctggaactggccctgaaccagggacgg
cgactgggcagagtcgctcagataggcgccaaaaccaagcccgtctcccagatgacatgc
atcgaagacgtgcaggaggcttttgaaatccagatgttccatggcataaaccgcctgctt
aaagacttgcaggccattgaaatcgccaacgcggaatatcatcccaccccgctatccagc
atgcttttggatggatgcctggaaaacggggcttgctccacccggggcggggcgcgctat
aatttttccggcattcagtgcgtggggctggtggacgcgggggattccctggccgccatc
aagcaggctgtgtttgaggataaaaagctcagtatggaggaattggtcgagcatctgaaa
aataatctgtcagacgaccggtggcggcattatttgctgaacatgcccaagttcggcaac
gacgatccctttgccgacgtctggaccgcctatgcactggacgttttcaaggccgccctg
gacggaaagacaagcacccggggcggcaagtacacggtgggcgtttattccgtcaccctg
cacgagtattgggggacggtggtctcggccttgccaaacggccgcagaaatggcgaaagc
ctgtccaacggcatgtctccctccaacggccaggatcgcaaaggccctacggctgtgttg
aattccatgaaccgcatcgattactcaaagacggacaacggcatcaatttcaatatcaag
ttcgacgcaaacaccgtgggaagcccggccggctgcacggccatgaaaagcatcttttcc
acctatttcaagcgcggaggcatgcaggcccagatcaacgtgctggaccccaaggttttg
atcgaagccagggacaacccggaagcctatccccatttgctggttcgggtgtccgggtat
tccgcctatttcaacgatctcaccccggccatgaaagaggagatgatccgccgcaccagc
atggggttgtaa

DBGET integrated database retrieval system