KEGG   Desulfatibacillum alkenivorans: Dalk_0058Help
Entry
Dalk_0058         CDS       T00813                                 

Definition
(GenBank) Short-chain specific acyl-CoA dehydrogenase
  KO
K16173  glutaryl-CoA dehydrogenase (non-decarboxylating) [EC:1.3.99.32]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00362  Benzoate degradation
dal01100  Metabolic pathways
dal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dalk_0058
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.32  glutaryl-CoA dehydrogenase (acceptor)
     Dalk_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 AP2
Motif
Other DBs
NCBI-ProteinID: ACL01768
UniProt: B8FKF3
Position
81779..82942
Genome map
AA seq 387 aa AA seqDB search
MIFELSKELQMLQKAVREFATKNIAPNADQWDADHYLPIKEVLKPMGELGFFGAVVPEEY
GGEGMGWLAASIITEEIARASSSLRVQINLLGLGCAYPIYKYGTEEAKKKYVEKLCRAQY
LGGFGITEPNAGSDVLAIETEATDMGDHYVLNGSKTWISNAHQADVIIIYAYTDKSAKTK
GLSAFIVEPRNFNGIKTTDLNKMGSHSSPTGELFFDNTRVPKENLLGKPGDGARIVFSSL
ANTRLSAAAGAVGCAQACLDIATKYITKREQFGKSVGTFQMNQDLIAQMTTEIEAARLLV
YKASWQKDQGMENNGMAVAQAKYFAGETAMKCANYGMRLMGAYGYSTEYPLARYYRDIPT
YVLVEGSANICKMIIAMDQLGYRKANR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgaactttccaaagagttgcaaatgcttcaaaaggccgtccgcgagtttgcc
acaaagaacatcgcccccaacgcggatcaatgggacgccgatcactacctgcccatcaag
gaagtcctgaagcccatgggtgaactgggctttttcggcgccgtcgtccccgaggaatac
ggcggagaaggcatgggctggctggcggcttccatcatcaccgaggaaatcgcccgggcc
tccagttccctccgggtgcagatcaaccttctgggcctgggctgcgcctatcccatatac
aaatacgggaccgaagaagctaaaaagaaatacgtggaaaaactctgccgcgcccaatac
ctgggcggcttcggcattaccgagcccaacgcaggctccgacgttctggccatcgagacc
gaagccacggacatgggcgatcactacgtgctgaacggctccaaaacctggatctccaac
gcccatcaggcggacgtcatcattatttacgcctatacagacaaatccgccaaaaccaag
ggcttgtccgcgttcatcgtggagcccaggaacttcaacggcatcaagaccacggaccta
aacaagatgggctcccactcttcgcccaccggcgaactgtttttcgacaacacccgcgtg
cccaaggaaaaccttttgggcaagcccggcgacggggccaggatcgtcttttcgtcattg
gccaacactcgcctttccgcagccgcaggagccgtgggatgcgcccaggcctgcctggat
atcgccacaaaatacatcaccaagagggagcaattcggcaagtccgtgggaacctttcag
atgaaccaggatctgatcgcccagatgaccacggaaatcgaggcggcccgacttctggtc
tacaaggcctcatggcagaaagaccagggcatggaaaataacggcatggccgtggcccag
gccaagtacttcgccggggaaaccgccatgaagtgcgccaactacggcatgcggcttatg
ggcgcctacggatattccacggaatatcccctggcccgctactaccgcgacatccccacc
tacgtactggtggaaggctcggccaacatctgcaagatgatcatcgccatggaccagttg
ggataccgtaaggccaacaggtaa

DBGET integrated database retrieval system