KEGG   Desulfatibacillum alkenivorans: Dalk_0807Help
Entry
Dalk_0807         CDS       T00813                                 

Definition
(GenBank) Putative superoxide dismutase, Ni-type (NiSOD)
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
dal  Desulfatibacillum alkenivorans
Brite
KEGG Orthology (KO) [BR:dal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dalk_0807
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dalk_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni TPR_MalT
Motif
Other DBs
NCBI-ProteinID: ACL02512
UniProt: B8FHU5
Position
1086277..1086720
Genome map
AA seq 147 aa AA seqDB search
MKKARTGLLAVLLVLGLFTANAMAHCEIPCGIYDDPMRIAMLNEHIATIEKSMKSIIELE
RADHPHYNQLVRWINNKEDHANQFQEIVTQYFMTQRIKLDAPDYDKKIATLHRMLVYAMK
CKQTTDLQNVVILRSLVKEFETLYFAK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgcgcaccggtttgttggcggtattgttggttctgggtctttttacggcc
aatgccatggcccattgcgaaatcccttgcggcatttacgacgatcccatgcggatcgcc
atgctgaacgaacacatcgccaccattgaaaagtccatgaagtcgatcatagaactggaa
agggcggatcatccccactacaaccagttagtgcggtggattaacaacaaggaggatcac
gccaaccaattccaggagatcgtgactcagtatttcatgacgcaacggatcaagctggac
gcccctgattacgacaagaaaattgcgacgctgcaccgcatgctggtttacgccatgaag
tgcaagcagaccacggacttgcagaacgttgtgattctgcggagtttggtcaaggaattt
gaaacgctctattttgcaaaataa

DBGET integrated database retrieval system