KEGG   Desulfatibacillum alkenivorans: Dalk_1066Help
Entry
Dalk_1066         CDS       T00813                                 

Definition
(GenBank) aminotransferase class-III
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00860  Porphyrin and chlorophyll metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
Module
dal_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dalk_1066
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dal01007]
    Dalk_1066
Enzymes [BR:dal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Dalk_1066
Amino acid related enzymes [BR:dal01007]
 Aminotransferase (transaminase)
  Class III
   Dalk_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ACL02769
UniProt: B8FK94
Position
complement(1426602..1427843)
Genome map
AA seq 413 aa AA seqDB search
MKTYTYPKSQELFQRAAKVIPCGIYGHLSPAPLIPADAYPFYASRAEGSKFWDVDGNEFI
DYMCAYGPMVLGYNYKPVDDAAAKQYAEANCVTSPGPVMVELAEKLTDVISMADWAFFAK
NGNDVTTYATMIARKATGRKKIVLIKGGYHGVAPWTQTYGHHGIMEEDGQHTIRIPWNDF
EAFKKVVDENPNDIAGFMATPYHHPTFVDNEMPLPGYWDKVQALCNAKGIVLIVDDIRCG
FRLDIRGSHEYFGFKPDLVCFCKAIGNGYPISALVGTEALKNDAAKVFYTGSYWFSAAPM
AAALKTINEMEAMDAVKMMTDFGESLKTGLIEVAANHGYDLKVTGHPAMPYLRITDDPTL
MLHQDWCAECTKRGAFFSSHHNWFISTAHTQEDLERTLEIADDAFEAIKKNKE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttacacttatccgaaaagccaggaactttttcagcgggccgccaaggtcatc
ccttgcggcatttacggccatttaagccccgccccgctcatcccggcggacgcctatcct
ttttatgcgtccagagccgagggctccaagttctgggatgtggacggcaacgaattcata
gactacatgtgcgcttacggccccatggttctgggctacaactacaagcccgtggacgat
gcggcggccaaacagtacgccgaagccaactgcgtcacttcacccggcccggtcatggtg
gagttggccgaaaaattgacggacgtgatttccatggccgattgggcttttttcgccaaa
aacggcaacgacgtcaccacctatgcaaccatgatcgcccgaaaagccacgggccgcaaa
aaaatcgtgctgatcaagggcggatatcatggcgtggcgccctggacccagacctacggc
caccatggcatcatggaggaggacggccagcacaccatccgtataccctggaacgatttt
gaagccttcaaaaaggtggtggatgaaaatcccaacgacatcgcgggctttatggccact
ccttaccaccacccgacctttgtggataacgaaatgcccctgccggggtactgggacaag
gtccaggccctatgcaacgccaagggcatcgtgttgatcgtggacgacatccggtgcggg
ttccggttggacatccggggctcccacgagtatttcgggtttaagcccgacctggtctgc
ttttgcaaggccatcggcaacgggtatcccatatccgccctggtggggaccgaagccctg
aaaaacgacgccgccaaggtgttttatacgggcagctactggttttccgccgcccccatg
gccgcggccctgaaaaccatcaacgaaatggaagccatggacgcggtcaagatgatgacc
gatttcggcgagagcctgaaaaccggcctgatagaggttgccgccaaccacggctacgac
ctgaaagtcaccggccatcccgccatgccgtatttgagaatcacggacgatcccacgctc
atgctgcatcaggattggtgcgcggaatgcaccaagcgcggagcgtttttttcgtcccat
cataactggtttatatccactgcgcatactcaggaggacctggaaaggaccctggaaata
gctgacgacgcctttgaggccatcaagaaaaacaaggaatag

DBGET integrated database retrieval system