KEGG   Desulfatibacillum alkenivorans: Dalk_1354Help
Entry
Dalk_1354         CDS       T00813                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00010  Glycolysis / Gluconeogenesis
dal00051  Fructose and mannose metabolism
dal00562  Inositol phosphate metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
dal01130  Biosynthesis of antibiotics
dal01200  Carbon metabolism
dal01230  Biosynthesis of amino acids
Module
dal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dal_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_1354
   00051 Fructose and mannose metabolism
    Dalk_1354
   00562 Inositol phosphate metabolism
    Dalk_1354
Enzymes [BR:dal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dalk_1354
Exosome [BR:dal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dalk_1354
  Exosomal proteins of bladder cancer cells
   Dalk_1354
  Exosomal proteins of melanoma cells
   Dalk_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM HGTP_anticodon
Motif
Other DBs
NCBI-ProteinID: ACL03055
UniProt: B8F9V9
Position
complement(1780066..1780827)
Genome map
AA seq 253 aa AA seqDB search
MDARTPLIAGNWKMFKTPQEAARDAAALAELVKGVEGVDVMIAPTFACLVPVAQALEGSA
VALGAQNMHWETEGAYTGELSGPMLKAAGCSHVIIGHSERRQYFGETDETVNKKIKAALE
AGLKAVLCIGETEEERDQEKTLNVLDKQLKDGLKDIFPGSGEDALVVAYEPVWAIGTGKT
ATDDQAQEAHAFIRKVLAELLGKDLAKSTRILYGGSVKPANIAALMSKPDIDGGLVGGAS
LDPETFSQIVKFQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggacgccagaacgccgcttatcgccggaaactggaaaatgttcaagactccccaggag
gccgcccgcgacgcggccgccctggctgaactggtcaagggcgtagaaggcgtggacgtg
atgatcgcccccaccttcgcctgtctggttcccgtagcgcaagccctggagggaagcgcc
gtcgccctgggcgctcagaatatgcactgggagaccgaaggcgcctatacgggcgaactc
tccggccctatgctcaaggctgcggggtgctcccacgtgatcatcggccactcggaacgg
cgccagtatttcggcgagaccgacgaaaccgtgaataagaagatcaaggccgctctggag
gcgggtttgaaggctgttttgtgcatcggcgagacggaagaggaaagagatcaggaaaaa
acgctgaatgtgcttgacaaacagctcaaagacggtctaaaagacatttttcccggctcg
ggggaggacgccttggtggtcgcctatgagcctgtctgggccatcggcaccggcaaaacc
gcaaccgatgatcaagcccaggaagcccatgcatttatccgcaaggttttggctgaattg
ttaggaaaagatcttgccaaatccacacgcatattgtatggggggagcgtcaaaccggcc
aacatcgcagcgctgatgagcaagccggatattgacggaggactggtcggcggcgccagc
ttggatcctgagactttctcgcaaatagtcaagttccaataa

DBGET integrated database retrieval system