KEGG   Desulfatibacillum aliphaticivorans: Dalk_1366
Entry
Dalk_1366         CDS       T00813                                 

Definition
(GenBank) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
dal  Desulfatibacillum aliphaticivorans
Pathway
dal00540  Lipopolysaccharide biosynthesis
dal01100  Metabolic pathways
Module
dal_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:dal00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Dalk_1366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dal01005]
    Dalk_1366
Enzymes [BR:dal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     Dalk_1366
Lipopolysaccharide biosynthesis proteins [BR:dal01005]
 Unusual sugar
  Dalk_1366
SSDB
Motif
Pfam: DAHP_synth_1
Other DBs
NCBI-ProteinID: ACL03066
UniProt: B8F9X0
Position
complement(1789077..1789898)
AA seq 273 aa
MTNTFSIGNNMNVGLGAPLLLIAGPCVIENEEKTLEIAERIKGIVRDMDVNFVFKASFDK
ANRTSIDSFRGPGLEQGLAILGKVKSRLGLPVISDVHSPDQVGPASEVLDILQIPAFLCR
QTDLLTAAGNSGKPVNVKKGQFVGPWDMKHVTGKVLSTGNERIMLTERGSSFGYNNLVVD
FRNFSIMRDLGFPVVFDATHSVQMPGGLGSCSGGDRSYVPLLARAAAAAGVDGVFFEVHT
DPDKALCDGPNSLTMEMLESILPQLLAIRKAAS
NT seq 822 nt   +upstreamnt  +downstreamnt
atgacgaacacattttcaatcggaaataacatgaacgtgggcctgggagcgcctttgctc
ctcattgccgggccttgcgtgatcgagaatgaggaaaaaacccttgagatcgcggagcgc
ataaagggaatcgtccgggacatggacgtcaactttgtgttcaaggcttcttttgacaag
gccaatcgcacgtccatagactcttttcgcggccccggcctggagcaagggctggctatc
ctgggcaaggtaaagtcccggcttgggttgccggtgatttccgacgtgcattccccggat
caggtggggccggcgtccgaggttcttgatatcctgcagattcccgcgtttctgtgccgg
cagaccgatcttttgacggccgcgggcaatagcggcaagcccgttaacgtgaaaaaaggc
cagttcgtaggcccctgggatatgaagcacgtgacgggcaaggttctgtccacgggcaac
gagcgcatcatgctcacggagcgcggcagcagctttggatataacaatctggtggtggat
ttcaggaatttcagcatcatgcgggatctgggctttcccgtggtgtttgacgccacccac
agcgtgcaaatgcccggaggcctgggaagctgctccggcggggatcggtcctatgttccc
ttgctggcccgggcggcggcggccgcgggggtggacggggtctttttcgaagtgcatacg
gacccggacaaagccctgtgcgacggccccaactcattgactatggaaatgctggaaagc
attttgccccaattactggctatcaggaaagcagcctcctga

DBGET integrated database retrieval system