KEGG   Desulfatibacillum alkenivorans: Dalk_1436Help
Entry
Dalk_1436         CDS       T00813                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01130  Biosynthesis of antibiotics
dal01230  Biosynthesis of amino acids
Module
dal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dalk_1436
Enzymes [BR:dal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dalk_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACL03136
UniProt: B8FA40
Position
complement(1878602..1879402)
Genome map
AA seq 266 aa AA seqDB search
MGNKPDILKVILEHKKLEVEACRTKVSEEALAEMAKADRQRRYFMQSLSQPGPFGANIIA
EVKRASPSKGIIREGLDPAVQAQAYEKGGAAAMSVLTDNKFFQGSNDDLKAARAACSLPV
IRKDFIVSLYQIYEAAVMGADAILLITRTLTVEFMQRALALCKELGLDALVEVHSEEELD
QAGAAGAKLVGVNNRDLKTFVTDIETTIRLHKRMTADQVAVCESGIKDRADIQRVMDAGV
FNFLIGETLVRSDDPAATIRELTGAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaaaccagatatcctgaaagtcatcctggagcataaaaagctggaggtggag
gcctgccgcaccaaggtttcggaagaggctctggcggaaatggccaaggccgaccggcaa
aggcggtatttcatgcaaagcctttcccagcccgggccttttggcgcaaacatcatcgcg
gaagtcaaaagagcctcgccctccaagggaattatccgggaggggctggacccggcggtt
caggctcaggcctatgaaaaaggcggcgctgcagctatgtcggttttgacggataacaag
tttttccaaggatcgaatgacgacctcaaggcggctcgggctgcatgctctttgcccgtc
atccgcaaggactttatcgtgtccttgtaccagatttacgaggcggcggtcatgggcgcg
gacgcaattttgctgatcaccagaaccttgaccgtggaattcatgcagcgggctttggcc
ttgtgcaaagaactgggtctggacgctctggtggaggttcattccgaggaggaactggat
caggccggagcggcgggcgccaagctggttggcgtgaataatcgggacctcaagaccttt
gtgacggacatcgaaaccaccattcggctgcacaagcgcatgaccgcggatcaggtcgcc
gtgtgcgaaagcggaatcaaggatcgcgccgacattcaacgagtgatggacgccggcgtc
ttcaactttctgatcggcgaaaccctggtgcgcagcgacgacccggcggcgaccatccga
gagttaacgggggcggcgtga

DBGET integrated database retrieval system