KEGG   Desulfatibacillum alkenivorans: Dalk_2424Help
Entry
Dalk_2424         CDS       T00813                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00030  Pentose phosphate pathway
dal01100  Metabolic pathways
dal01120  Microbial metabolism in diverse environments
dal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dalk_2424
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Dalk_2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACL04117
UniProt: B8FB31
Position
3154996..3156732
Genome map
AA seq 578 aa AA seqDB search
MDKILRINMGAEGGPKLIEDPLGDYEGLGGRAMTSAVVLKEVPADCHPLGEENKFVIAPG
MLSGTLGAQTGRISVGCKSPLTGGIKEANSGGQAAQVLARLGYAAIILEGKPADGSCYKI
VINKDGVSISEDKSLAGLGNYAVVEKVKAEYGDKVATISIGPAGEMKMGAASVAFSDMEM
RPTRHAGRGGVGAVMGAKGVKLIVLDDEGMPRRQAKDVEAFKDANKRFVAGLNSHPVTSQ
GLPAFGTNVLVNVVNEAGGFPTRNFKTGRFEGASKISGETMAEQTAARGGVVTRGCHKGC
VIRCSGDYTGPDGKWLTKQPEYETVWAHGANCGIDDLDVIAQLDRIDDDLGLDTIEMGNA
IAVAMDAGLAEFGDGEAALKLMDEVAKGTALGRIIGNGAGAVGKMFGVENVPVVKNQSLP
AYDPRAVQGIGVTYATSTQGGDHTAGYAVATNLMKVGGDVDPLKPEGNVELSRNLQIATA
SIDASGMCLFIAFAIMDQPETFQALLDMINAHYGYSWTADDWAEFGMQILRNEREFNKAA
GFTNLDDRLPKYFKKLPLAPHNITFQVTDAELDSVFNF
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatcttacgaatcaacatgggcgccgaaggcggccccaaactcattgaagac
cctctgggagactacgaaggcctgggcggccgggccatgacctcggcggttgtgctgaag
gaagtgcctgcggactgccatcccttgggggaagaaaacaagttcgtcattgctcccggc
atgttgagcgggacattgggcgcgcagaccggccgtatttccgtggggtgcaaaagcccg
ttgaccggcggcatcaaggaggccaactccggcggccaggcggcccaagtgctggcgagg
ctgggctacgcagccatcattctggaaggcaagccggctgacggctcctgctacaagatc
gtaatcaacaaggacggcgtttccatctctgaggacaaatccctggctggattgggcaac
tatgcggttgtggagaaggtgaaggccgagtacggcgacaaggtggccaccatctccatc
ggcccggccggcgaaatgaagatgggcgccgcgtccgtggctttttccgacatggaaatg
cgccccacccgccatgcgggccgcgggggcgtgggcgccgtcatgggcgccaagggcgtc
aaattgatcgtcctggacgacgaaggcatgccccgccgtcaggccaaggacgtggaggcc
ttcaaggacgccaacaaacgctttgtggcgggcctgaactcccatcccgtcaccagccaa
ggccttccggctttcggcaccaacgttctggtgaacgtggtgaacgaggccggcggcttt
cccaccagaaacttcaagaccggccgttttgaaggcgcctccaagatcagcggcgagacc
atggccgaacaaaccgccgcccgcggcggcgtggtcacgcgcggctgccacaagggctgc
gtgatccgttgctcaggcgactacaccgggcctgacggaaaatggctcaccaagcagcct
gagtacgaaaccgtttgggcgcacggcgccaattgcggcatcgacgacctggacgtcatc
gctcagttggaccgcatcgacgacgacctgggcctggacaccattgaaatgggcaacgcc
attgctgtggccatggacgcaggcctggccgaattcggcgacggcgaagcggcgctcaag
ctcatggacgaagtggccaaaggcacggctttgggccgcattatcggcaacggcgccggc
gcagtgggcaagatgttcggcgtggaaaacgtgccggtggtcaaaaaccagtccctgccc
gcctacgaccccagggccgtccagggcatcggcgtgacctacgccaccagcacccagggc
ggagaccacaccgcgggctacgccgtggccaccaacctcatgaaggtgggcggcgacgtg
gatccgctcaagcccgaaggcaatgtggagctttcccgcaacctgcagatcgccacggcg
tccatcgacgcctcgggcatgtgcctgttcatcgccttcgccatcatggatcagccggaa
accttccaggccctgctggacatgatcaacgcccattacggctattcgtggaccgcggac
gactgggcggaattcggcatgcaaattctcaggaacgagcgggaattcaacaaggccgcc
ggcttcaccaacttggacgaccggctgcccaagtactttaaaaagctgcctctggcgccg
cacaacatcaccttccaggtgacggacgccgagttggactcggtcttcaacttctaa

DBGET integrated database retrieval system