KEGG   Desulfatibacillum alkenivorans: Dalk_3159Help
Entry
Dalk_3159         CDS       T00813                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00900  Terpenoid backbone biosynthesis
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dalk_3159
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Dalk_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NmrA
Motif
Other DBs
NCBI-ProteinID: ACL04849
UniProt: B8FBU6
Position
complement(4014255..4015439)
Genome map
AA seq 394 aa AA seqDB search
MSLSDKIRVKNLTILGSTGSIGKSTLGVVRKFPDQFKIRALAAHTSIDALAEQVVEFLPE
LVVVRDKDLAGKLSTALQGASTPHPYIMYGEEGYQKAATLDSVDMVVSSMVGAAGLLPTL
AAIRARKQVALANKETLVMAGALVMREARENGVKLMPIDSEHSAIFQCLQGNDRKDLDKI
LLTASGGPFRTVSREKFESLKPEDALSHPTWDMGAKITIDSSTLMNKGLEVIEAKWLFDV
RQQDIQVVVHPQSIVHSMVAYKDGSVIAQLGVPDMAGAIAYAMSYPDRLPLGQPIPDFFA
LGSLEFFEPDLEKFPCLALAQQACRDEQTYPAVLNAANEIAVQAFLDHQIRFPQIPQLIE
KCLNVHTPSARPDLEQILEADAWARDYIKQAARS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttgtccttatcagataaaattcgcgtaaaaaacctgaccatcctgggctcgaccggctcc
atcggaaaaagcaccctgggcgtggttcgcaagtttcccgatcaatttaaaatccgcgcc
ctggccgcccataccagcatagacgccctggccgagcaggttgtggagtttctgcctgag
ttggttgtggtccgggataaggacctggccggtaagctgagcaccgccttgcagggcgcc
tcaaccccgcatccctacattatgtatggggaggaagggtatcaaaaggccgcaaccctg
gattccgtggatatggtcgtatcctccatggtgggcgcagccgggcttttgcccacgttg
gccgccatccgggccaggaaacaagtggccctggccaacaaggaaaccctggtcatggcc
ggcgccctggtcatgcgggaagccagggaaaacggcgtcaagctcatgcccatagactcc
gagcacagcgccatattccagtgcctgcaaggcaacgaccgtaaggatctggataaaatt
ctgctgacggcctccggcggcccttttcgcacggtttcccgggagaaattcgaaagccta
aagcccgaagacgctttgtcccatccaacctgggacatgggcgcaaaaatcaccatcgat
tcgtccacgctcatgaacaaaggcctggaggtcatcgaggccaaatggctgtttgacgtg
cgccaacaggacatccaggtggtggtccatccccagagcattgttcactccatggtggcc
tacaaagatggctcggttattgcccaattaggcgtaccggatatggccggcgccatagcc
tacgccatgtcctatccggaccggcttcccttggggcagcccatcccggatttctttgca
ttaggctctttggagttttttgagcccgacctggaaaaatttccctgcctggccctggct
cagcaggcttgcagggacgaacaaacctatccggcggtattgaacgccgccaacgaaatt
gcggtgcaggcttttctggatcatcaaatccggtttccccaaatcccgcaattgatcgaa
aaatgcctgaacgtccacaccccgagcgcccggcccgatctggagcagatcctggaagcc
gacgcctgggccagggattatataaagcaggctgcgaggtcttaa

DBGET integrated database retrieval system