KEGG   Desulfatibacillum alkenivorans: Dalk_3533Help
Entry
Dalk_3533         CDS       T00813                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00860  Porphyrin and chlorophyll metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dalk_3533
Enzymes [BR:dal01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Dalk_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat MCM AAA_16 AAA_22 AAA AAA_29 AAA_3 DUF815 FtsK_SpoIIIE AAA_30 NACHT Phage_G
Motif
Other DBs
NCBI-ProteinID: ACL05221
UniProt: B8FC16
Position
4481662..4482693
Genome map
AA seq 343 aa AA seqDB search
MKRKTVFPFAAIVGQDMMKLALILNVINPTLSGVLIRGEKGTGKSTAVRALADILPEIDV
ISDCPFELSPQDEQDAYEECMTALTGEAPKSGDLESYKRKVRVVELPVGATEDRVVGTLD
LEHALRKGTKRVEPGLLAAAHRGILYVDEVNLLDDHIVDVLLDSAAMGVNTIEREGVSFS
HPAKFTLVGTMNPEEGELRPQLLDRFGLCVHVTGVEDMESRVLIMKRRVAFDENPANFTA
QFDQESANIAQSITKAREVYPKVKVPESMYAEIAKCCLEVGVDGHRADIIMLKTAKTLAA
YDAREEVAPKDIETASQLVLPHRVRRVPLQDVVTDISAARGRK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaagacggtatttccctttgcagcaatcgtaggtcaggacatgatgaaactg
gccttgattttgaacgtaatcaaccccaccctttccggcgtactgattcgcggggaaaaa
ggaactggaaaatccacggccgtgcgcgccctggccgatattctgccggaaatcgacgtg
atttccgactgcccttttgagctttcgccccaagacgaacaggacgcttatgaagaatgt
atgaccgccctgaccggagaagcgccgaaaagcggcgacctggaatcttacaaaagaaaa
gtccgggtggtggagcttcctgtaggcgccacggaagaccgggttgtgggcaccctggac
ctggagcacgctttgcgcaaagggaccaaaagggtggagcccggccttttggccgccgcg
caccggggaattttgtacgtggacgaagtcaaccttttggacgaccacattgtagacgtg
cttctggactccgcggccatgggcgtgaacaccatcgaacgcgagggggtcagcttttcc
cacccggccaagtttactctggtgggcaccatgaaccccgaagaaggggagcttcggccc
cagttgctggaccgctttgggctttgcgtgcatgtgaccggcgtggaagacatggaatcc
cgggtgctgatcatgaagcgccgggtcgcttttgacgaaaacccggccaatttcaccgcc
caattcgaccaggagtccgccaacatcgcccagagcataaccaaagccagggaggtgtat
cccaaggtgaaggttccggaatccatgtatgcggaaatcgccaaatgctgcctggaagtg
ggcgtggacgggcatcgggccgacatcatcatgctgaagaccgccaagaccctggccgcg
tacgacgcccgggaagaggtggcacccaaagacattgaaaccgcatctcaactggtgctg
ccccatcgcgtcaggcgggttcccctccaggacgtggttacggacatcagcgcggcccgg
ggaagaaaatga

DBGET integrated database retrieval system