KEGG   Desulfatibacillum alkenivorans: Dalk_4943Help
Entry
Dalk_4943         CDS       T00813                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase (thiolase II-like)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00071  Fatty acid degradation
dal00072  Synthesis and degradation of ketone bodies
dal00280  Valine, leucine and isoleucine degradation
dal00310  Lysine degradation
dal00362  Benzoate degradation
dal00380  Tryptophan metabolism
dal00620  Pyruvate metabolism
dal00630  Glyoxylate and dicarboxylate metabolism
dal00640  Propanoate metabolism
dal00650  Butanoate metabolism
dal00900  Terpenoid backbone biosynthesis
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
dal01130  Biosynthesis of antibiotics
dal01200  Carbon metabolism
dal01212  Fatty acid metabolism
dal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dalk_4943
   00630 Glyoxylate and dicarboxylate metabolism
    Dalk_4943
   00640 Propanoate metabolism
    Dalk_4943
   00650 Butanoate metabolism
    Dalk_4943
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dalk_4943
   00072 Synthesis and degradation of ketone bodies
    Dalk_4943
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dalk_4943
   00310 Lysine degradation
    Dalk_4943
   00380 Tryptophan metabolism
    Dalk_4943
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dalk_4943
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dalk_4943
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dalk_4943
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dal04147]
    Dalk_4943
Enzymes [BR:dal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dalk_4943
Exosome [BR:dal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dalk_4943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACL06615
UniProt: B8FDI4
Position
complement(6099273..6100454)
Genome map
AA seq 393 aa AA seqDB search
MRDVVIVSGVRTAIGGYMGSLSTLSAVELGVAALNGAVEKAGIDKAEIQEVVCGQCNQAG
SPGNTARHIAIGAGLPAESFAFTVHQQCASSMRGAELLAQEIMLGKVDAGVAVGVESMSN
APYLLMGARKGYRLNDGERIQDSLMIGGLVDALLGYHMGVTAENIAERYDISREEQDEWA
LMSHQRAVAATEAGWFKDEILPVEIKTRKGIVTFDTDEHPRADTTLESLARLKPVFKKGG
TVTAGNASGLNDAGACILMMAADKAASLGLKPLARVVSSAPGSVEPEVMGLGVVPAVKNA
LRFAKMDLADMDYFEFNEAFAAQVIGCNREFGLDVDRINAAGSGISLGHPVGATGVRLIV
TMINQLRRRNERFGCASLCASGGPGHAFIVETL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgttgtgattgtcagcggggtcagaacggctattggcgggtacatgggatcg
ctctccacgttgtccgccgtagagcttggggtcgccgccctgaatggagcggttgagaag
gcgggaatagacaaggcggagattcaggaagtggtttgcggccagtgcaatcaggccggc
tctcccggaaacaccgcccggcatattgccataggggcggggctgccggcggagtctttc
gcctttacggtgcatcagcagtgcgcctcctccatgcggggagcggagcttttggctcag
gagatcatgctgggcaaggttgacgccggcgtcgccgtgggcgtcgaaagcatgagcaat
gcgccttatctgctcatgggggcgcgcaaaggatatcgcctcaatgacggagaacgcatt
caggacagccttatgatcggcggactggtggacgcccttctgggataccacatgggggtg
actgccgaaaacatcgccgaacgctatgatatctcccgagaggagcaggacgagtgggct
ctcatgagtcatcagagggccgtcgcagccacggaagccggatggttcaaggatgaaatc
ctcccggttgaaatcaagacccgaaaagggatcgtaacctttgacacggatgagcatccc
cgggccgacaccaccctggagagtttagcccgcctcaagcctgtgttcaaaaaagggggg
accgtgaccgccgggaacgcgtccgggctgaacgacgccggggcctgcatccttatgatg
gcggcggacaaggcagcctcgctgggcctcaagcccttggccagggtcgtaagctcggcc
ccggggtcggttgagcctgaggtcatggggctgggggtggttccggcggtgaaaaacgcc
ctcaggtttgcaaagatggacctggccgacatggattattttgaattcaatgaggctttc
gccgcccaggtgatcggatgcaaccgggagtttggattggatgtggatcgcataaatgcg
gccggctccggaatcagtctcggccacccggtgggcgccacaggcgtgcgtctcatcgtt
accatgatcaaccaattgcggcggcgcaacgaacggttcggctgcgcgtccttgtgcgcc
agcggcggtccggggcatgctttcatcgtggaaaccctgtag

DBGET integrated database retrieval system