KEGG   Drosophila ananassae: Dana_GF10248Help
Entry
Dana_GF10248      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11310  general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF10248
Transcription machinery [BR:dan03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dana_GF10248
Chromosome and associated proteins [BR:dan03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dana_GF10248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSF_A Sec2p
Motif
Other DBs
NCBI-GeneID: 6493121
NCBI-ProteinID: XP_001957088
FlyBase: FBgn0087289
UniProt: B3M7Y6
Position
Unknown
AA seq 696 aa AA seqDB search
MTKCSENASGDGQDFKKHETLKFQCLAKGEVVQDCVSDFVASQRCEGFIALSGSKMDVVT
LEMTSQAQPLNPFPYTPSYIELSASEPRPLDALAEKVDLEKVYTDCQILDAQELALETVY
TAVCSATVPSSLLKAVKKAPRLLPTGNYLLAVLNTHGSLTLLTKSVECTLWSRFESLNVP
LTLRDNLLPSVEADGISTFGQYKAMMDQAWITMFAWLGEESEGVENHSLVLGTANGGLWI
LKLSADAQTLEDHIYLETKLDRICFLHTFDNLLLVADVMGRVHLYRFTEWSNGGLTLVRS
LWERADRMGLQVGTISRSLEGNCYYITCCKAAHLLTWCLQGEDCLEARLHVGGIKITALC
SLDYQSYVVGTASQELKLIQVTHQGSQIHIKMQPVTVEDMSDFQVVGLATSRNKNLLTLL
LYPVKEYINAKKTEKNIVYVQVGQLHEHDVLARLTDSLNSDKPINVCLDYLAELRIKIFS
QKDLQGYSNFSPLDAFNFAEPATEAQLHQLQLKYHVLTTVGELQMAHLHLSTLIKKTQDE
TQLLLAMLATTHIRLRLQYLGSLDNLSGFQEQAANCMLAEAQRLCNGLQKDLTGEEHPLK
DTTRHFLHQIENHFQELRKKFAKISVTNPVEEQTALWCSISYVEIEPSLENRYCSLCSRQ
VLMQIQDLQQLFDPNLTPQLVCPFCHGSFTQELLTA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatgttctgaaaacgcttcaggcgatggccaagatttcaagaaacatgagacc
ctcaagttccagtgccttgccaagggagaggttgtacaggactgcgtgtcggattttgtt
gccagccaacggtgtgaaggtttcatagccctgtcgggttccaagatggatgtggtcact
ttggagatgacgtcccaagcccagcctctcaatccctttccctacacaccttcatacatc
gaattgtcggcctcggagccccggcctctggatgccctagccgagaaggtggatctggag
aaggtgtacaccgactgtcagatcctagatgcccaagagctggccttggaaacggtctat
acggcggtttgctccgcgactgttccatcatcccttttgaaggctgtgaaaaaagcgccg
cgtctactgcccactggtaactatctcctggcggtcctcaacactcatggatcgctaacg
ctgctgaccaagtcggtggaatgcacactatggagtcgcttcgaaagtctcaacgtgccc
ctcactctaagggacaatctcctgccgagtgtcgaggcagatgggataagtactttcggc
caatacaaagccatgatggaccaggcatggatcacaatgtttgcttggcttggcgaggaa
tcggagggggtggagaaccattccttggttctgggaactgccaatggaggcctgtggatc
ctcaagctctctgccgatgcccagacactagaagatcacatttatctcgaaaccaaactg
gatcgtatttgctttctgcatactttcgataatctgctgcttgtagccgatgtcatggga
agggtgcatctgtaccgcttcaccgaatggtccaatggcggactgaccctggtccgaagt
ctgtgggagagggcggatcgcatgggtctgcaagtgggtacgatttctcgaagcttggag
gggaactgctattacataacctgctgcaaggcagcgcatttgctgacctggtgccttcaa
ggagaggactgcttggaagcacgtctgcatgtcggcggaataaagatcacggcgttgtgc
agcctagactaccagagttatgtggtgggaacggcaagtcaggaactgaaactcattcaa
gtaacccaccagggtagccagatccacattaagatgcagccggtgaccgtggaagacatg
agtgacttccaggtggtgggactcgccactagcaggaacaagaatctgctgaccctgctc
ctctaccccgttaaggagtacataaatgcgaaaaaaactgaaaagaatattgtgtacgtt
caagtgggccaactccatgagcatgatgtcctagctcggctcaccgatagcctaaattcc
gacaaacccatcaatgtctgcctggactaccttgccgaacttcgcatcaagatattttcc
cagaaggacttacagggatactcgaattttagtccgttggatgcctttaatttcgcggag
ccggccacggaagcccagctgcatcaactgcaactgaaataccatgtcctgacgacggta
ggcgaactgcaaatggcccacctgcacctttccacgctcatcaaaaagacgcaggacgaa
acccaactgcttctggcaatgctggccaccacgcacataagacttcgactccagtatctg
ggttccctcgacaatctgtcaggatttcaggagcaagctgcgaactgcatgctggcggag
gcccagcgcctatgtaatggcctccaaaaagatttgacgggagaggagcatcctctcaag
gataccacaagacactttctgcatcaaatagagaatcactttcaagagctacgcaaaaag
tttgccaagatcagtgtaacaaatcctgtagaggagcagacagctctgtggtgttccatt
tcttatgtggagattgagcccagcttggagaatcgctactgcagcctgtgcagtcggcag
gtcctgatgcagatccaggacctgcagcagctgttcgaccccaacctgaccccccagctg
gtgtgtcctttctgccacgggagcttcacccaggaactgttaactgcataa

DBGET integrated database retrieval system