KEGG   Drosophila ananassae: Dana_GF10522Help
Entry
Dana_GF10522      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dan  Drosophila ananassae
Pathway
dan00010  Glycolysis / Gluconeogenesis
dan00562  Inositol phosphate metabolism
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF10522
   00562 Inositol phosphate metabolism
    Dana_GF10522
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dana_GF10522
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dana_GF10522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 6493392
NCBI-ProteinID: XP_001957661
FlyBase: FBgn0087563
UniProt: B3M4H3
Position
Unknown
AA seq 467 aa AA seqDB search
MRFLFLLLLPLVALAQDDDYCFSQDTSRPQTRQFSSKTAYQIVKGSDIERQYLVPNCEPK
KMWIFHRHGTRLPKKSMINKASRLAELRDLIVKNYKVLKTKPDKDPLCQTDLIALQMWKW
NSSITGDMEEYLTAQGYDDLRGTAKLYQRYYPNVLPKEYNDTYYQFRHTDTQRTTESFKA
FAEGLFGTVNSAHPVDIPKQDLLLRPYDYCQSYKDLNYKGEGSEFEKYHQSTVWKNNLVD
ISTRLGFQYTLEEEDIKLMYDICRYEQAWQVDRNSVWCGAFLPEQVTVFEYAEDLKYYYG
SGYGFEEIERLNCRLVQDLLTHLSNPVSPHVVAHFGHSTGLLTLITALGIKKDGVKLRAD
NYLDLASRRWKSSLIDPFASNFVAVKYDCPQELDREKVVFFLNQDAVQLDWCNVGLCKWS
DVLAKYKTISDADCGEYFCRSGATSSLASGVSMLATSLVALLVYLMH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcttgttcctgctcctgctgcccttagtggccctagcccaggacgatgactac
tgcttcagccaggacacgtcgcggccccaaacccgtcagttctcctcgaagaccgcctac
cagattgtcaaaggcagcgacatcgaacgccagtatctggtgcccaactgtgagcccaag
aagatgtggatcttccacagacacggcacccgactgcccaagaagagcatgatcaacaag
gcatccagattagccgagcttcgcgatcttatcgtaaagaactacaaagttttaaagacc
aagccggataaggaccccttgtgccaaacggatctgattgctcttcagatgtggaagtgg
aatagcagcatcacgggcgacatggaggagtacctgaccgcccagggatacgacgatctg
cggggaacagccaaactgtatcagcgctattatcccaatgtgcttcccaaggaatataat
gacacctattaccagttccggcatacggacacccagcgcactactgagagtttcaaggcc
tttgccgaaggactctttggaacagtgaactctgcccatcccgtcgacattcccaaacag
gatctgcttctacgtccctacgattactgccagtcctacaaggatcttaactacaagggc
gagggttcggagttcgaaaagtatcaccagtccaccgtgtggaaaaacaatcttgtggac
atctccacgcgactgggtttccagtacacactggaggaggaggatatcaagctgatgtac
gatatttgtcgttacgagcaggcatggcaggtggaccggaacagtgtgtggtgcggagca
ttcctgccggagcaggtgaccgtcttcgagtacgcagaggacctcaagtattactatgga
tccggctatggattcgaggagatcgagcgtttaaactgccgcttggtacaggacctactt
acccacctgagcaacccggtgtcgccccatgtggtcgcccatttcggccactccacgggc
cttctcaccctcatcacggctctgggcattaagaaggacggcgtcaagctgcgggcggac
aactacctggacctggccagccgccgctggaagagcagtctgatcgatcctttcgccagt
aactttgtggccgtaaagtacgattgtccgcaggagcttgaccgcgagaaggtcgtcttc
ttcctcaaccaggacgccgtccagctagactggtgcaatgtgggcctgtgcaagtggtcg
gatgtcctggccaagtacaagaccatctcggatgcggactgtggggaatatttctgccgg
agtggcgccacttcgtccctggcatccggagtttccatgctggccacttcgctggtcgct
ctgctggtctacttaatgcactaa

DBGET integrated database retrieval system