KEGG   Drosophila ananassae: Dana_GF12026Help
Entry
Dana_GF12026      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dan  Drosophila ananassae
Pathway
dan03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dana_GF12026
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dan03041]
    Dana_GF12026
Enzymes [BR:dan01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Dana_GF12026
Spliceosome [BR:dan03041]
 Complex C
  Other components
   Step II factors
    Dana_GF12026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE Flavi_DEAD AAA_30 AAA
Motif
Other DBs
NCBI-GeneID: 6494884
NCBI-ProteinID: XP_001959493
FlyBase: FBgn0089065
UniProt: B3MD00
Position
Unknown
AA seq 1251 aa AA seqDB search
MDELQQLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNRSYDSFRKALLENGAEFP
DSLVQNLQRIINLMRPGRTGGSSEEVTVSNGADDKKSQLKKLFPGLALPNDKYSKQKGSD
GEEDEKEDKKEKKQVQASLNKTDMSDVDAAMLELEALAPGEAPAEVKPSKESSSKDRHKR
RERSRSKGRDRDARKRSRSREDRDRDRVRDRRRSRSRDKDRDRRRRSRSRDNRRRSRSRE
DRDRRRRRSSSRDRHERRRRSRSRSGDRRDKRDHERSEKMPPPTAAMTDDPEAGKIYSGK
VANIVPFGCFVQLFGVRKRWEGLVHISQLRAEGRVTDVTEVVSRNQAVKVKVMSITGQKV
SLSMKEVDQESGRDLNPLSHVAEEDSLRDRNPDGPFSSSTSQLNLQGGVVDGDEHESRKR
VTRISSPERWEIKQMISSGVLDRSEMPDFDEETGLLPKDEDDEADIEIEIVEEEPPFLSG
HGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEMEALPTSLNKNWID
PLPEEDSSRTLAANMRGMGAAPAEVPEWKKHVIGGKKSSFGKKTDLTLIEQRQSLPIYKL
RDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRV
AEEYGCRLGQEVGYTIRFEDCTSPETIVKYMTDGMLLRECLMEAELKSYSVIMLDEAHER
TIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTK
EPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIIL
PVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTG
MDSLVVTPISQAAAKQRAGRAGRTGPGKCYRLYTERAYRDEMLPTPVPEIQRTNLATTVL
QLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLS
KMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYN
SWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSG
FFRNAAKKDPQEGYRTLVDSQIVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDP
KWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
atggacgagctgcagcagttggagtacctgtcgttggtctcaaagatctgcacagagctg
gacaaccatctgggcataaacgataaggacctggccgagttcatcatcgacttggaaaac
aagaatcgttcctacgactcctttcgcaaggctctgctggagaatggagctgagttcccg
gactccctggttcaaaatctgcagcgcatcatcaacctgatgcgaccgggaagaactgga
ggctctagcgaagaggttactgtgtccaatggagcggatgataagaagtctcaactcaag
aagctcttcccaggcctggctctacccaatgacaagtacagcaaacagaagggcagcgac
ggggaggaggacgagaaggaggacaagaaggaaaagaagcaagtgcaagccagcctcaac
aaaaccgacatgagcgacgtggatgctgccatgttagagctcgaagccctggctcccgga
gaagcaccagccgaggtgaaaccttcaaaggaatcaagttccaaggatcgtcacaagcgc
agggagcggagccgaagcaaaggaagagatagggatgctcgcaaacggagcagatcccga
gaggatcgggatcgagatcgagtcagagatcgtcggagaagccggtccagagataaggac
agagaccgccggcgtcgtagtagatcccgcgataaccgtcgacgcagcagatcgcgcgaa
gatcgcgaccggcggcgtcggagatcgagttctagggatcgccatgagcgccgtagacgc
agtcgatcacggtctggcgaccgcagggataaaagagatcacgagcgcagtgaaaagatg
ccgccgcctacagccgcaatgaccgatgatcccgaagcgggaaagatctactccggcaag
gtggcgaacatcgttccattcggctgttttgttcaactatttggagtgaggaagcgctgg
gagggattggtacacatatcccaactgagagccgagggaagggtcacagatgtcaccgaa
gtggtcagccgaaatcaagcggtgaaggtgaaagtgatgtccataaccggacagaaggta
tcgctttctatgaaggaagtggatcaggaaagcgggcgggatctaaaccctctatcccac
gttgccgaagaggattctttgagggatcgcaatcctgatggaccgttcagcagcagcact
tcacagctgaatctgcagggcggggtggtggatggtgatgaacacgagtccagaaagcgc
gtcactagaatctccagtcccgagcgttgggagattaagcagatgatcagttccggggtg
ctggacaggagtgagatgccagactttgacgaggaaactgggttgctgccgaaggatgag
gacgacgaagcggacatcgaaatagagattgttgaggaggagccgccgttcctctccggg
cacggaagagccctgcacgatctctcgcccgttaggattgtcaagaatcccgatggctcc
ctggcccaggcagctatgatgcagtcggccctctcgaaagagcgccgagagcagaagatg
ctgcagcgcgagcaggagatggaggctctacccacaagtctcaacaagaactggatagat
ccgctaccggaggaagacagctcccgcaccctggcggccaatatgcgcggcatgggagcc
gctccggcggaagtgcccgaatggaagaagcacgtcattggcggcaagaagtcctccttc
ggcaagaagaccgacttgaccctcatagagcagcggcagtccctgcccatttacaagttg
cgggatgatctgatcaaggcggttactgacaaccagatactcatcgtcattggagaaacg
ggttccggcaagacgacgcaaattacccagtatctgggagagtgtggattcacggccagg
gggaagattggctgcacccagccgaggagagtggcggccatgtcggtggccaagcgtgtg
gccgaggagtacggttgtcgtctgggccaggaagtgggctacacgattcgtttcgaggac
tgcaccagcccggagaccattgttaagtacatgacagacggtatgttgctccgcgaatgc
ctcatggaggcggagctgaagagctactccgtgattatgttggacgaggcccacgagcgc
acaattcacacggacgtactctttggattgctcaagacagccgtacagaagaggccggaa
ctgaagctgattgttacttctgccactctggatgccgtgaagttttcacagtacttcttc
aaggcgccaattttcacgattcccggcaggaccttccccgtggaggtcttgtacacgaag
gagccggagacggactatctggacgcctctctgatcacagtgatgcagattcacctgcga
gaaccacctggcgacattctgttgttcttaaccggccaggaggagatcgacactgcctgc
gagatcctgtacgagaggatgaagagtcttggcccagatgttccagagctcatcatatta
ccggtgtattccgccctgccctccgagatgcagactcgtattttcgacccagcgcccgcg
ggcagtcgaaaggtggtcattgccaccaatattgctgagacttcgttgaccatcgatgga
atcttctacgtggtggaccctggctttgtcaaacagaaggtctacaattccaagacgggc
atggactctctggtggtcactccgatttcgcaggcagcagccaagcagcgagcgggaaga
gctggacgaactggtcctggcaagtgctacagactgtacacggagcgcgcgtacagagat
gagatgctgcccacccctgtgcccgagatccagcgtactaacttagccaccacggtgctg
cagctgaagaccatggggatcaatgatttgctgcactttgacttcatggacgcgccacca
gtggagtctctggtaatggcactggagcagctgcactccctctcggcgctggatgacgaa
ggactgctgacccgattgggcaggcgaatggcggagtttcccctggaacccaacctctcc
aaaatgctgatcatgtctgtggccctgcagtgttccgatgaaatcttaaccatcgtttcg
atgctgagtgttcagaatgtgttctacaggcccaaggataagcaagctctggcggatcag
aagaaggccaagttcaatcaggcggaaggtgaccatctaacattgcttgccgtctacaac
agttggaagaacaacaaattctcgaatgcctggtgctacgagaacttcgtccagatccga
actctgaagcgcagtcaggacgtgaggaaacaactgcttggaataatggacagacataaa
ttggacgtggtctccgctggaaagaactctgtgcggattcagaaggccatttgctcggga
ttcttccgcaatgcggccaagaaagatccacaggagggctatcgcaccttggtcgattcc
cagatcgtgtacatccatccatcgagcgctctcttcaaccggcaaccggagtgggtcatc
taccacgaactggtgcagacaacaaaggaatacatgcgcgaggtgaccaccatagatcca
aagtggttggtggaatttgctccctctttcttccgattctcggaccccacaaagttgagc
aaattcaagaagaaccagcgcctggaaccgctgtacaacaagtacgaggagcccaatgcc
tggcgtatctcacgcgtccggcgacgccgcaattaa

DBGET integrated database retrieval system