KEGG   Drosophila ananassae: Dana_GF12115Help
Entry
Dana_GF12115      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dan  Drosophila ananassae
Pathway
dan00040  Pentose and glucuronate interconversions
dan00053  Ascorbate and aldarate metabolism
dan00830  Retinol metabolism
dan00860  Porphyrin and chlorophyll metabolism
dan00980  Metabolism of xenobiotics by cytochrome P450
dan00982  Drug metabolism - cytochrome P450
dan00983  Drug metabolism - other enzymes
dan01100  Metabolic pathways
Module
dan_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dana_GF12115
   00053 Ascorbate and aldarate metabolism
    Dana_GF12115
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dana_GF12115
   00860 Porphyrin and chlorophyll metabolism
    Dana_GF12115
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dana_GF12115
   00982 Drug metabolism - cytochrome P450
    Dana_GF12115
   00983 Drug metabolism - other enzymes
    Dana_GF12115
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dana_GF12115
Glycosyltransferases [BR:dan01003]
 Others
  Hydrophobic molecule
   Dana_GF12115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_trans_4_2 Glyco_transf_28 Glyco_trans_4_4 Glyco_transf_4 CLASP_N
Motif
Other DBs
NCBI-GeneID: 6494973
NCBI-ProteinID: XP_001959303
FlyBase: FBgn0089154
UniProt: B3MBV4
Position
Unknown
AA seq 530 aa AA seqDB search
MHFILLAYLLLAGKLYSPNGSVDGAKILAAYSFPGTSHFMMQKALMRELIKSGHQVTMIT
ARSLKSENLGSNFTEILIEPVYDFWHDVKLDFGALHLFELTRMTNPDFIKMLEIIGVKTT
EHALKQPKVQALIHAKQTEGVFDLFIAEQFYGEALLPLARVYKVPVVTTSTLAYENHMSQ
IMGLITPWSFVPHGFLPFTDHMSFWERLQNSYTSLHQDLYRLLVYFPKMDAVAQEFFGPV
LGEVPKVRQLEKETSVMLLNSHAPLTTARPTVDAFVSVGGMHIYPPKALPEDLQQFLDEA
EEGAIYFSLGSNVQSKDMPPEMLQLFLQVFGSLRQRVLWKFEDESVSKLPENVMVRKWLP
QADILAHRNIKVFITHGGLFGTQEGVHYAVPLLGIPIYCDQHLNMNKAVWGGYAISLHFQ
SITEEILRHSLDQLLHNATYKENIQRVSNIFRDRPLEARKTAIYWIEYVIRHRGAPHMRS
AGLDLNWFQFYLLDVIAFVAFIPVAVILILCLVIKLLRGNDKKVKKAKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcattttgctggcttatctgttactggctgggaagctatattccccgaacgga
tctgtagatggagccaagattctggcagcttattcttttccgggcacgtcccacttcatg
atgcagaaggctctgatgagagaactcatcaaaagtggacatcaggtaacaatgatcacg
gccaggtctctgaagagtgagaatctgggcagtaacttcacggaaatactaatagagcca
gtctatgatttttggcacgatgttaagctggactttggagccctacacctgttcgagctg
actcgtatgacgaacccggacttcatcaagatgctggagattattggagttaagaccacg
gaacatgctctgaagcagcccaaggtccaggctctgatccatgccaagcagaccgaagga
gtctttgacctgttcattgcggaacagttctacggggaggcgttgctgcctctggcccgg
gtgtacaaggtgccagtggtgactaccagtaccctggcctatgagaatcacatgagccag
ataatgggactgattacaccgtggtcctttgtgcctcacggctttctgcccttcacggat
cacatgagcttctgggaaaggctccagaactcgtacacctcgctccaccaggacttgtac
agattgctcgtttatttccccaaaatggacgctgtggcccaggagttcttcggcccggtt
ctgggtgaggtgcccaaggtgaggcagctggagaaggaaacctcagtgatgctcttaaac
agtcacgcacctctgaccacggcacgccctactgtggatgccttcgtgtcggtgggtggc
atgcacatctacccgcccaaagcactccccgaggacctgcaacaattcctggacgaggcc
gaggagggggccatctacttcagcctcggcagcaatgtccagagcaaggacatgccgccc
gaaatgctgcaactgttcctgcaggtattcggatccctaaggcagcgagtcctgtggaag
tttgaagacgaaagcgtatcgaagttgccggaaaatgtaatggtgcggaagtggctgcca
caagcggatattctggcccaccgcaacatcaaggtattcatcacccacggcgggctcttt
ggcacccaggaaggtgtccattatgccgttcctctgctaggcattcccatatactgcgac
cagcacctgaacatgaacaaagccgtttggggcggctatgccatcagcttgcacttccaa
tccataaccgaggagattctgaggcactctttggaccagttattacacaatgccacctat
aaggagaacatccagcgggtgtcgaatatctttagagatcgtccattggaagcccgcaaa
acggccatctactggatagaatacgtcatccggcatcggggagctcctcacatgcggtcc
gctggtttggatctcaactggttccagttttatcttctggatgtgatagcctttgtggct
tttattcctgtagctgtcattctaattctttgtttggttatcaaactacttagaggcaat
gacaagaaggttaagaaggccaagacacattag

DBGET integrated database retrieval system