KEGG   Drosophila ananassae: Dana_GF13003Help
Entry
Dana_GF13003      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dan03110]
    Dana_GF13003
Enzymes [BR:dan01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Dana_GF13003
Chaperones and folding catalysts [BR:dan03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Dana_GF13003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 6495846
NCBI-ProteinID: XP_001959705
FlyBase: FBgn0090036
UniProt: B3MEC1
Position
Unknown
AA seq 205 aa AA seqDB search
MKLILSALLVALVAGIVCADDAKGPKVTDKVFFDITIGGEPAGRVVIGLFGKTVEKTVRN
FKELAEKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGA
GWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKVLSGMNVVRQIENSATDARDRPVK
DVVIANSGTLDVPEPFSVAKADATD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgattttatccgcgctgctggtagcccttgtggccggcattgtctgtgccgac
gacgccaaagggcccaaagtgaccgacaaggtcttctttgacatcaccattggcggtgag
cccgctggacgtgttgtgattggactgtttggcaagactgttgagaagaccgtgaggaac
ttcaaggagctggcggagaagccccagggcgaaggctacaagggtagcaagttccaccgc
atcatcaaggacttcatgatccagggtggcgacttcaccaagggcgatggcaccggcgga
cgttccatctatggcgagcgcttcgaggacgagaacttcaagctgaagcactatggcgcc
ggctggctgagcatggccaacgctggcaaggacaccaacggctcccagttcttcatcacc
accaagcagaccagctggttggatggccgccacgtcgtcttcggcaaggtcctgtccggc
atgaatgttgtgcgccaaatcgagaacagcgccaccgatgcccgcgaccgtcccgtcaag
gatgttgtcatcgccaacagtggcactctggatgtcccagagccgttctccgttgccaag
gctgatgccaccgattaa

DBGET integrated database retrieval system